DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. PLoS biology 2015 imex curation Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. DIP original experiment: DIP-264938X PLoS biology 2015 IMEx GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. PLoS biology 2015 imex curation Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. DIP original experiment: DIP-264937X PLoS biology 2015 IMEx GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. PLoS biology 2015 imex curation Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. DIP original experiment: DIP-264932X PLoS biology 2015 IMEx GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. PLoS biology 2015 imex curation Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. DIP original experiment: DIP-264919X PLoS biology 2015 IMEx GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. PLoS biology 2015 imex curation Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. DIP original experiment: DIP-264920X PLoS biology 2015 IMEx GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. PLoS biology 2015 imex curation Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. DIP original experiment: DIP-264925X PLoS biology 2015 IMEx GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. PLoS biology 2015 imex curation Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. DIP original experiment: DIP-264924X PLoS biology 2015 IMEx GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. PLoS biology 2015 imex curation Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. DIP original experiment: DIP-264922X PLoS biology 2015 IMEx GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. PLoS biology 2015 imex curation Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. DIP original experiment: DIP-264939X PLoS biology 2015 IMEx GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. PLoS biology 2015 imex curation Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. DIP original experiment: DIP-264930X PLoS biology 2015 IMEx GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. PLoS biology 2015 imex curation Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. DIP original experiment: DIP-264931X PLoS biology 2015 IMEx GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. PLoS biology 2015 imex curation Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. DIP original experiment: DIP-264927X PLoS biology 2015 IMEx GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. PLoS biology 2015 imex curation Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. DIP original experiment: DIP-264921X PLoS biology 2015 IMEx GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. PLoS biology 2015 imex curation Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. DIP original experiment: DIP-264934X PLoS biology 2015 IMEx GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. PLoS biology 2015 imex curation Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. DIP original experiment: DIP-264935X PLoS biology 2015 IMEx GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. PLoS biology 2015 imex curation Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. DIP original experiment: DIP-264933X PLoS biology 2015 IMEx GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. PLoS biology 2015 imex curation Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. DIP original experiment: DIP-264923X PLoS biology 2015 IMEx GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. PLoS biology 2015 imex curation Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. DIP original experiment: DIP-264917X PLoS biology 2015 IMEx GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. PLoS biology 2015 imex curation Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. DIP original experiment: DIP-264928X PLoS biology 2015 IMEx GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. PLoS biology 2015 imex curation Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. DIP original experiment: DIP-264929X PLoS biology 2015 IMEx GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. PLoS biology 2015 imex curation Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. DIP original experiment: DIP-264918X PLoS biology 2015 IMEx GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. PLoS biology 2015 imex curation Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. DIP original experiment: DIP-264936X PLoS biology 2015 IMEx GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. PLoS biology 2015 imex curation Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. DIP original experiment: DIP-264926X PLoS biology 2015 IMEx GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. p49841-2 Glycogen synthase kinase-3 beta GSK3B Serine/threonine-protein kinase GSK3B GSK-3beta2 neuron-specific protein protein human Homo sapiens Human MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKDSSGTGHFTSGVRVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST DIP protein P49841-2 original sequence version: 150 DIP protein P49841-2 original sequence version: 191 May play a specific role in axon growth and neurite outgrowth. Reduced binding to AXIN1, reduced ability to phosphorylate MAPT/TAU. gdib_human Rab GDP dissociation inhibitor beta Guanosine diphosphate dissociation inhibitor 2 GDI2 RABGDIB protein protein human Homo sapiens Human MNEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESASITPLEDLYKRFKIPGSPPESMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVTEGSFVYKGGKIYKVPSTEAEALASSLMGLFEKRRFRKFLVYVANFDEKDPRTFEGIDPKKTTMRDVYKKFDLGQDVIDFTGHALALYRTDDYLDQPCYETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPIEEIIVQNGKVIGVKSEGEIARCKQLICDPSYVKDRVEKVGQVIRVICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISFAHNVAAQGKYIAIVSTTVETKEPEKEIRPALELLEPIEQKFVSISDLLVPKDLGTESQIFISRTYDATTHFETTCDDIKNIYKRMTGSEFDFEEMKRKKNDIYGED DIP protein P50395 original sequence version: 92 DIP protein P50395 original sequence version: 137 CE186A2E3A47FCC9 q8bmd2-1 Zinc finger protein DZIP1 Dzip1 Kiaa0996 DAZ-interacting protein 1 homolog protein protein mouse Mus musculus Mouse MPFQKHVYYPLANSPEGPDASAIGAAPMAFVPPSAASGPLPFFQFRPRLESVDWRRLSAIDVDKVAGAVDVLTLQENIMNITFCKLEDEKCPHCQSGVDPVLLKLIRLAQLTIEYLMHSQEFLTSQLNLVEERLRLSLLDYEQSKQLLTKQAGEIKLLKEECKRRKKMLSTQQLMIEAKASYYQCHFCDKAFMNQAFLQSHIQRRHTEDSHLEYNTKAQTDRLQKEIDMLKEQLQLTRSQLESAQHSHAVRFSKDYEMQKSKEEDFLKLFDRWKEEEKEKLLEEMEKVKGMFMREFKELTSKNSALEYQLLEIQKSNIQIKSNIGTLRDVTELREDHLPCPQDFQNMLQLLDSQASKWTDRFQVLNEEHSKEKGQLLSHIEKLRSSMMKDLSADNVFYKRRVEELGQKLQEQNELIISQKQQIREFASKPYSSISELKGTPLTRQTLEPKSAAPTTPMTASATQNLDGASSLTMVHEQVFSSHILEPIEELSSEEEKGRENEQKLNKKTSLRKPSSTSPSPQELRTNLERELGNKLRSFGIGANIQGIPCEILNRSLKAMQVARHDLAKQMPDIQQIRESLEHQLICKMEEKVSLSSDRHHVPSMTTFPPEEVPKATQLPHKSRPLVRQRTVFTDKVSVPKLKKNTKESHFLRRFPSTKTPPFSSEEEPDEEDLLHAYLSPDSLATAATQPPKSSMSHFGKSAVKSDTDWTEGSEMDDSDFSPKLTGTSITIQTDTVETMALPQGSGNKAVPGMNPADTVIKKESLQELKCTDADDEDWDISSLEEEKSLGSKIEQREPPPAKRDPSCTQVQRAWGPVNPREFKEEGLHENEPSTLKSNLVTVTDWSDVLDV DIP protein Q8BMD2-1 original sequence version: 96 rab10_mouse Ras-related protein Rab-10 Rab10 protein protein mouse Mus musculus Mouse MAKKTYDLLFKLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELQGKKIKLQIWDTAGQERFHTITTSYYRGAMGIMLVYDITNGKSFENISKWLRNIDEHANEDVERMLLGNKCDMDDKRVVPKGKGEQIAREHGIRFFETSAKANINIEKAFLTLAEDILRKTPVKEPNSENVDISSGGGVTGWKSKCC DIP protein P61027 original sequence version: 110 7F02B8E8E46EE1E8 rab8a_mouse Ras-related protein Rab-8A Rab8a Mel Rab8 Oncogene c-mel protein protein mouse Mus musculus Mouse MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSSHGVKITVEQQKRTSFFRCSLL DIP protein P55258 original sequence version: 143 AC89DC85588FB8F8 dzip1_human Zinc finger protein DZIP1 DAZ-interacting protein 1/2 DZIP1 DZIP DZIP2 KIAA0996 protein protein human Homo sapiens Human MQAEAADWFSSMPFQKHVYYPLASGPEGPDVAVAAAAAGAASMACAPPSAASGPLPFFQFRPRLESVDWRRLSAIDVDKVAGAVDVLTLQENIMNITFCKLEDEKCPHCQSGVDPVLLKLIRLAQFTIEYLLHSQEFLTSQLHTLEERLRLSHCDGEQSKKLLTKQAGEIKTLKEECKRRKKMISTQQLMIEAKANYYQCHFCDKAFMNQAFLQSHIQRRHTEENSHFEYQKNAQIEKLRSEIVVLKEELQLTRSELEAAHHASAVRFSKEYEMQKTKEEDFLKLFDRWKEEEKEKLVDEMEKVKEMFMKEFKELTSKNSALEYQLSEIQKSNMQIKSNIGTLKDAHEFKEDRSPYPQDFHNVMQLLDSQESKWTARVQAIHQEHKKEKGRLLSHIEKLRTSMIDDLNASNVFYKKRIEELGQRLQEQNELIITQRQQIKDFTCNPLNSISEPKGNPLAWQAFESQPAAPAVPMNAPALHTLETKSSLPMVHEQAFSSHILEPIEELSEEEKGRENEQKLNNNKMHLRKALKSNSSLTKGLRTMVEQNLMEKLETLGINADIRGISSDQLHRVLKSVESERHKQEREIPNFHQIREFLEHQVSCKIEEKALLSSDQCSVSQMDTLSTGEVPKMIQLPSKNRQLIRQKAVSTDRTSVPKIKKNVMEDPFPRKSSTITTPPFSSEEEQEDDDLIRAYASPGPLPVPPPQNKGSFGKNTVKSDADGTEGSEIEDTDDSPKPAGVAVKTPTEKVEKMFPHRKNVNKPVGGTNVPEMFIKKEELQELKCADVEDEDWDISSLEEEISLGKKSGKEQKEPPPAKNEPHFAHVLNAWGAFNPKGPKGEGLQENESSTLKSSLVTVTDWSDTSDV DIP protein Q86YF9 original sequence version: 102 4C5A7B9438D40623 gsk3b_mouse Glycogen synthase kinase-3 beta Gsk3b Serine/threonine-protein kinase GSK3B protein protein mouse Mus musculus Mouse MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASPPANATAASDTNAGDRGQTNNAASASASNST DIP protein Q9WV60 original sequence version: 159 200C3FD1B38B4883 rab8a_canlf Ras-related protein Rab-8A RAB8A MEL RAB8 Oncogene c-mel protein protein canlf Canis familiaris (dog) Canis lupus familiaris Dog Canis familiaris MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITPDQQKRSSFFRCVLL DIP protein P61007 original sequence version: 98 mint May be involved in vesicular trafficking and neurotransmitter release AA52DBF54A2CD056 rab3i_human Rab-3A-interacting protein Rabin-3 SSX2-interacting protein RAB3IP RABIN8 protein protein human Homo sapiens Human MGLKKMKGLSYDEAFAMANDPLEGFHEVNLASPTSPDLLGVYESGTQEQTTSPSVIYRPHPSALSSVPIQANALDVSELPTQPVYSSPRRLNCAEISSISFHVTDPAPCSTSGVTAGLTKLTTRKDNYNAEREFLQGATITEACDGSDDIFGLSTDSLSRLRSPSVLEVREKGYERLKEELAKAQRELKLKDEECERLSKVRDQLGQELEELTASLFEEAHKMVREANIKQATAEKQLKEAQGKIDVLQAEVAALKTLVLSSSPTSPTQEPLPGGKTPFKKGHTRNKSTSSAMSGSHQDLSVIQPIVKDCKEADLSLYNEFRLWKDEPTMDRTCPFLDKIYQEDIFPCLTFSKSELASAVLEAVENNTLSIEPVGLQPIRFVKASAVECGGPKKCALTGQSKSCKHRIKLGDSSNYYYISPFCRYRITSVCNFFTYIRYIQQGLVKQQDVDQMFWEVMQLRKEMSLAKLGYFKEEL DIP protein Q96QF0 original sequence version: 71 DIP protein Q96QF0 original sequence version: 112 DD77781823038F15 rab8a_human Ras-related protein Rab-8A Oncogene c-mel RAB8A MEL RAB8 protein protein human Homo sapiens Human MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITPDQQKRSSFFRCVLL DIP protein P61006 original sequence version: 82 DIP protein P61006 original sequence version: 100 DIP protein P61006 original sequence version: 128 DIP protein P61006 original sequence version: 132 AA52DBF54A2CD056 gdib_mouse Rab GDP dissociation inhibitor beta Gdi2 Gdi3 GDI-3 Guanosine diphosphate dissociation inhibitor 2 protein protein mouse Mus musculus Mouse MNEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDQNPYYGGESASITPLEDLYKRFKLPGQPPASMGRGRDWNVDLIPKFLMANGQLVKMLLFTEVTRYMDFKVIEGSFVYKGGKIYKVPSTEAEALASSLMGLFEKRRFRKFLVYVANFDEKDPRTFEGVDPKKTSMRDVYKKFDLGQDVIDFTGHSLALYRTDDYLDQPCCETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPIEEIIVQNGKVVGVKSEGEIARCKQLICDPSYVKDRVEKVGQVIRVICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISFAHNVAAQGKYIAIVSTTVETKEPEKEIRPALELLEPIEQKFVSISDLFVPKDLGTDSQIFISRAYDATTHFETTCDDIKDIYKRMTGSEFDFEEMKRKKNDIYGED DIP protein Q61598 original sequence version: 130 483B7C7456B30525 dzip1_mouse Zinc finger protein DZIP1 DAZ-interacting protein 1 homolog Dzip1 Kiaa0996 protein protein mouse Mus musculus Mouse MPFQKHVYYPLANSPEGPDASAIGAAPMAFVPPSAASGPLPFFQFRPRLESVDWRRLSAIDVDKVAGAVDVLTLQENIMNITFCKLEDEKCPHCQSGVDPVLLKLIRLAQLTIEYLMHSQEFLTSQLNLVEERLRLSLLDYEQSKQLLTKQAGEIKLLKEECKRRKKMLSTQQLMIEAKASYYQCHFCDKAFMNQAFLQSHIQRRHTEDSHLEYNTKAQTDRLQKEIDMLKEQLQLTRSQLESAQHSHAVRFSKDYEMQKSKEEDFLKLFDRWKEEEKEKLLEEMEKVKGMFMREFKELTSKNSALEYQLLEIQKSNIQIKSNIGTLRDVTELREDHLPCPQDFQNMLQLLDSQASKWTDRFQVLNEEHSKEKGQLLSHIEKLRSSMMKDLSADNVFYKRRVEELGQKLQEQNELIISQKQQIREFASKPYSSISELKGTPLTRQTLEPKSAAPTTPMTASATQNLDGASSLTMVHEQVFSSHILEPIEELSSEEEKGRENEQKLNKKTSLRKPSSTSPSPQELRTNLERELGNKLRSFGIGANIQGIPCEILNRSLKAMQVARHDLAKQMPDIQQIRESLEHQLICKMEEKVSLSSDRHHVPSMTTFPPEEVPKATQLPHKSRPLVRQRTVFTDKVSVPKLKKNTKESHFLRRFPSTKTPPFSSEEEPDEEDLLHAYLSPDSLATAATQPPKSSMSHFGKSAVKSDTDWTEGSEMDDSDFSPKLTGTSITIQTDTVETMALPQGSGNKAVPGMNPADTVIKKESLQELKCTDADDEDWDISSLEEEKSLGSKIEQREPPPAKRDPSCTQVQRAWGPVNPREFKEEGLHENEPSTLKSNLVTVTDWSDVLDV DIP protein Q8BMD2 original sequence version: 96 mint May participate in spermatogenesis via its interaction with DAZ BF786BAE227DBD47 gdi2-dzip1-1 1 35 unspecified role unspecified role prey prey mouse Mus musculus Mouse 25 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association gsk3b-12 14 24 putative self putative self unspecified role unspecified role P49841-2:p.Lys85Arg K85R mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain K R This feature has been corrected as a result of our quality control procedures. The original label was 'K85R'. Wed May 02 18:27:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys85arg' Tue Jun 30 17:44:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys85Arg' ecolx Escherichia coli phosphorylation phosphorylation reaction phosphorylation true dzip1-rab8a-1 18 35 unspecified role unspecified role bait bait mouse Mus musculus Mouse 28 unspecified role unspecified role prey prey mouse Mus musculus Mouse physical association physical association dzip1-gdi2-1 10 26 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Region 1-600 Region 1-600 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Region 430-852 Region 430-852 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 25 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association gdi2-rab8a-1 6 28 unspecified role unspecified role prey prey mouse Mus musculus Mouse 25 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association dzip1-gsk3b-1 15 26 enzyme target enzyme target substrate substrate unspecified role unspecified role Q8BMD2-1:p.Ser520Ala S520A mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain S A This feature has been corrected as a result of our quality control procedures. The original label was 'S520A'. Wed May 02 18:42:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser520ala' Tue Jun 30 19:59:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser520Ala' Region 1-378 Region 1-378 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Region 594-852 Region 594-852 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Region 373-600 Region 373-600 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 24 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli phosphorylation phosphorylation reaction phosphorylation rab8a-dzip1-1 21 35 unspecified role unspecified role prey prey mouse Mus musculus Mouse 28 unspecified role unspecified role bait bait mouse Mus musculus Mouse physical association physical association dzip1-gsk3b-2 2 26 enzyme target enzyme target substrate substrate unspecified role unspecified role Region 373-600 Region 373-600 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 24 enzyme enzyme unspecified role unspecified role P49841-2:p.Lys85Arg K85R mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain K R This feature has been corrected as a result of our quality control procedures. The original label was 'K85R'. Wed May 02 19:54:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys85arg' Tue Jun 30 17:19:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys85Arg' ecolx Escherichia coli phosphorylation phosphorylation reaction phosphorylation rab8a-gdi2-1 11 31 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P61007:p.Thr22Asn T22N mutation mutation certain certain sequence position certain certain certain sequence position certain T N This feature has been corrected as a result of our quality control procedures. The original label was 'T22N'. Wed May 02 18:59:35 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr22asn' Tue Jun 30 17:14:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr22Asn' human Homo sapiens Human 25 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association dzip1-gdi2-2 8 35 unspecified role unspecified role bait bait mouse Mus musculus Mouse 34 unspecified role unspecified role prey prey mouse Mus musculus Mouse physical association physical association gsk3b-dzip1-1 12 29 unspecified role unspecified role prey prey human Homo sapiens Human 24 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human physical association physical association rab8a-gdi2-2 17 31 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P61007:p.Thr22Asn T22N mutation mutation certain certain sequence position certain certain certain sequence position certain T N This feature has been corrected as a result of our quality control procedures. The original label was 'T22N'. Wed May 02 17:02:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr22asn' Tue Jun 30 16:30:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr22Asn' human Homo sapiens Human 25 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association rab8a-dzip1-2 4 31 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P61007:p.Thr22Asn T22N mutation increasing strength mutation increasing interaction strength mutation increasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain T N This feature has been corrected as a result of our quality control procedures. The original label was 'T22N'. Wed May 02 14:41:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr22asn' Tue Jun 30 15:40:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr22Asn' P61007:p.Gln67Leu Q67L mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain Q L This feature has been corrected as a result of our quality control procedures. The original label was 'Q67L'. Wed May 02 14:54:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln67leu' Tue Jun 30 17:07:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln67Leu' human Homo sapiens Human 26 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human physical association physical association dzip1-gsk3b-3 23 35 unspecified role unspecified role bait bait mouse Mus musculus Mouse 30 unspecified role unspecified role prey prey mouse Mus musculus Mouse physical association physical association rab8a-dzip1-3 22 31 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P61007:p.Thr22Asn T22N mutation mutation certain certain sequence position certain certain certain sequence position certain T N This feature has been corrected as a result of our quality control procedures. The original label was 'T22N'. Wed May 02 14:40:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr22asn' Tue Jun 30 16:45:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr22Asn' human Homo sapiens Human 26 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Region 1-600 Region 1-600 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Region 430-852 Region 430-852 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human physical association physical association gdi2-dzip1-2 3 35 unspecified role unspecified role prey prey mouse Mus musculus Mouse 28 unspecified role unspecified role prey prey mouse Mus musculus Mouse 25 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli association association gsk3b-dzip1-2 19 26 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human 24 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human physical association physical association gdi2-dzip1-3 7 28 unspecified role unspecified role prey prey mouse Mus musculus Mouse 26 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Region 430-600 Region 430-600 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 25 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli association association rab10-dzip1-1 5 27 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 26 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human physical association physical association gdi2-dzip1-4 16 33 unspecified role unspecified role prey prey human Homo sapiens Human 26 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human 25 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli association association rab3ip-rab8a-4 9 31 unspecified role unspecified role prey prey P61007:p.Thr22Asn T22N mutation increasing strength mutation increasing interaction strength mutation increasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain T N This feature has been corrected as a result of our quality control procedures. The original label was 'T22N'. Wed May 02 15:12:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr22asn' Tue Jun 30 19:48:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr22Asn' Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 32 unspecified role unspecified role bait bait Region 101-316 Region 101-316 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain YFP-tag YFP-tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range GFP-tag GFP-tag cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association gdi2-dzip1-5 20 35 unspecified role unspecified role prey prey mouse Mus musculus Mouse 34 unspecified role unspecified role bait bait mouse Mus musculus Mouse physical association physical association dzip1-rab8a-2 13 31 unspecified role unspecified role prey prey P61007:p.Thr22Asn T22N mutation increasing strength mutation increasing interaction strength mutation increasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain T N This feature has been corrected as a result of our quality control procedures. The original label was 'T22N'. Wed May 02 15:15:19 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr22asn' Tue Jun 30 19:00:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr22Asn' Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 26 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human physical association physical association