DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Impeding the interaction between Nur77 and p38 reduces LPS-induced inflammation. Impeding the interaction between Nur77 and p38 reduces LPS-induced inflammation. Nature chemical biology 2015 imex curation Li L., Liu Y., Chen HZ., Li FW., Wu JF., Zhang HK., He JP., Xing YZ., Chen Y., Wang WJ., Tian XY., Li AZ., Zhang Q., Huang PQ., Han J., Lin T., Wu Q. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Li L., Liu Y., Chen HZ., Li FW., Wu JF., Zhang HK., He JP., Xing YZ., Chen Y., Wang WJ., Tian XY., Li AZ., Zhang Q., Huang PQ., Han J., Lin T., Wu Q. DIP original experiment: DIP-266211X Nature chemical biology 2015 IMEx Impeding the interaction between Nur77 and p38 reduces LPS-induced inflammation. Impeding the interaction between Nur77 and p38 reduces LPS-induced inflammation. Impeding the interaction between Nur77 and p38 reduces LPS-induced inflammation. Nature chemical biology 2015 imex curation Li L., Liu Y., Chen HZ., Li FW., Wu JF., Zhang HK., He JP., Xing YZ., Chen Y., Wang WJ., Tian XY., Li AZ., Zhang Q., Huang PQ., Han J., Lin T., Wu Q. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Li L., Liu Y., Chen HZ., Li FW., Wu JF., Zhang HK., He JP., Xing YZ., Chen Y., Wang WJ., Tian XY., Li AZ., Zhang Q., Huang PQ., Han J., Lin T., Wu Q. DIP original experiment: DIP-266218X Nature chemical biology 2015 IMEx Impeding the interaction between Nur77 and p38 reduces LPS-induced inflammation. Impeding the interaction between Nur77 and p38 reduces LPS-induced inflammation. Impeding the interaction between Nur77 and p38 reduces LPS-induced inflammation. Nature chemical biology 2015 imex curation Li L., Liu Y., Chen HZ., Li FW., Wu JF., Zhang HK., He JP., Xing YZ., Chen Y., Wang WJ., Tian XY., Li AZ., Zhang Q., Huang PQ., Han J., Lin T., Wu Q. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Li L., Liu Y., Chen HZ., Li FW., Wu JF., Zhang HK., He JP., Xing YZ., Chen Y., Wang WJ., Tian XY., Li AZ., Zhang Q., Huang PQ., Han J., Lin T., Wu Q. DIP original experiment: DIP-266212X Nature chemical biology 2015 IMEx Impeding the interaction between Nur77 and p38 reduces LPS-induced inflammation. Impeding the interaction between Nur77 and p38 reduces LPS-induced inflammation. Impeding the interaction between Nur77 and p38 reduces LPS-induced inflammation. Nature chemical biology 2015 imex curation Li L., Liu Y., Chen HZ., Li FW., Wu JF., Zhang HK., He JP., Xing YZ., Chen Y., Wang WJ., Tian XY., Li AZ., Zhang Q., Huang PQ., Han J., Lin T., Wu Q. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Li L., Liu Y., Chen HZ., Li FW., Wu JF., Zhang HK., He JP., Xing YZ., Chen Y., Wang WJ., Tian XY., Li AZ., Zhang Q., Huang PQ., Han J., Lin T., Wu Q. DIP original experiment: DIP-266217X Nature chemical biology 2015 IMEx Impeding the interaction between Nur77 and p38 reduces LPS-induced inflammation. Impeding the interaction between Nur77 and p38 reduces LPS-induced inflammation. Impeding the interaction between Nur77 and p38 reduces LPS-induced inflammation. Nature chemical biology 2015 imex curation Li L., Liu Y., Chen HZ., Li FW., Wu JF., Zhang HK., He JP., Xing YZ., Chen Y., Wang WJ., Tian XY., Li AZ., Zhang Q., Huang PQ., Han J., Lin T., Wu Q. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Li L., Liu Y., Chen HZ., Li FW., Wu JF., Zhang HK., He JP., Xing YZ., Chen Y., Wang WJ., Tian XY., Li AZ., Zhang Q., Huang PQ., Han J., Lin T., Wu Q. DIP original experiment: DIP-266214X Nature chemical biology 2015 IMEx Impeding the interaction between Nur77 and p38 reduces LPS-induced inflammation. Impeding the interaction between Nur77 and p38 reduces LPS-induced inflammation. Impeding the interaction between Nur77 and p38 reduces LPS-induced inflammation. Nature chemical biology 2015 imex curation Li L., Liu Y., Chen HZ., Li FW., Wu JF., Zhang HK., He JP., Xing YZ., Chen Y., Wang WJ., Tian XY., Li AZ., Zhang Q., Huang PQ., Han J., Lin T., Wu Q. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Li L., Liu Y., Chen HZ., Li FW., Wu JF., Zhang HK., He JP., Xing YZ., Chen Y., Wang WJ., Tian XY., Li AZ., Zhang Q., Huang PQ., Han J., Lin T., Wu Q. DIP original experiment: DIP-266215X Nature chemical biology 2015 IMEx Impeding the interaction between Nur77 and p38 reduces LPS-induced inflammation. Impeding the interaction between Nur77 and p38 reduces LPS-induced inflammation. Impeding the interaction between Nur77 and p38 reduces LPS-induced inflammation. Nature chemical biology 2015 imex curation Li L., Liu Y., Chen HZ., Li FW., Wu JF., Zhang HK., He JP., Xing YZ., Chen Y., Wang WJ., Tian XY., Li AZ., Zhang Q., Huang PQ., Han J., Lin T., Wu Q. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Li L., Liu Y., Chen HZ., Li FW., Wu JF., Zhang HK., He JP., Xing YZ., Chen Y., Wang WJ., Tian XY., Li AZ., Zhang Q., Huang PQ., Han J., Lin T., Wu Q. DIP original experiment: DIP-266219X Nature chemical biology 2015 IMEx Impeding the interaction between Nur77 and p38 reduces LPS-induced inflammation. Impeding the interaction between Nur77 and p38 reduces LPS-induced inflammation. Impeding the interaction between Nur77 and p38 reduces LPS-induced inflammation. Nature chemical biology 2015 imex curation Li L., Liu Y., Chen HZ., Li FW., Wu JF., Zhang HK., He JP., Xing YZ., Chen Y., Wang WJ., Tian XY., Li AZ., Zhang Q., Huang PQ., Han J., Lin T., Wu Q. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Li L., Liu Y., Chen HZ., Li FW., Wu JF., Zhang HK., He JP., Xing YZ., Chen Y., Wang WJ., Tian XY., Li AZ., Zhang Q., Huang PQ., Han J., Lin T., Wu Q. DIP original experiment: DIP-266210X Nature chemical biology 2015 IMEx Impeding the interaction between Nur77 and p38 reduces LPS-induced inflammation. Impeding the interaction between Nur77 and p38 reduces LPS-induced inflammation. Impeding the interaction between Nur77 and p38 reduces LPS-induced inflammation. Nature chemical biology 2015 imex curation Li L., Liu Y., Chen HZ., Li FW., Wu JF., Zhang HK., He JP., Xing YZ., Chen Y., Wang WJ., Tian XY., Li AZ., Zhang Q., Huang PQ., Han J., Lin T., Wu Q. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Li L., Liu Y., Chen HZ., Li FW., Wu JF., Zhang HK., He JP., Xing YZ., Chen Y., Wang WJ., Tian XY., Li AZ., Zhang Q., Huang PQ., Han J., Lin T., Wu Q. DIP original experiment: DIP-266213X Nature chemical biology 2015 IMEx Impeding the interaction between Nur77 and p38 reduces LPS-induced inflammation. Impeding the interaction between Nur77 and p38 reduces LPS-induced inflammation. Impeding the interaction between Nur77 and p38 reduces LPS-induced inflammation. Nature chemical biology 2015 imex curation Li L., Liu Y., Chen HZ., Li FW., Wu JF., Zhang HK., He JP., Xing YZ., Chen Y., Wang WJ., Tian XY., Li AZ., Zhang Q., Huang PQ., Han J., Lin T., Wu Q. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Li L., Liu Y., Chen HZ., Li FW., Wu JF., Zhang HK., He JP., Xing YZ., Chen Y., Wang WJ., Tian XY., Li AZ., Zhang Q., Huang PQ., Han J., Lin T., Wu Q. DIP original experiment: DIP-266220X Nature chemical biology 2015 IMEx Impeding the interaction between Nur77 and p38 reduces LPS-induced inflammation. Impeding the interaction between Nur77 and p38 reduces LPS-induced inflammation. Impeding the interaction between Nur77 and p38 reduces LPS-induced inflammation. Nature chemical biology 2015 imex curation Li L., Liu Y., Chen HZ., Li FW., Wu JF., Zhang HK., He JP., Xing YZ., Chen Y., Wang WJ., Tian XY., Li AZ., Zhang Q., Huang PQ., Han J., Lin T., Wu Q. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Li L., Liu Y., Chen HZ., Li FW., Wu JF., Zhang HK., He JP., Xing YZ., Chen Y., Wang WJ., Tian XY., Li AZ., Zhang Q., Huang PQ., Han J., Lin T., Wu Q. DIP original experiment: DIP-266216X Nature chemical biology 2015 IMEx Impeding the interaction between Nur77 and p38 reduces LPS-induced inflammation. mk14_mouse Mitogen-activated protein kinase 14 Mapk14 Crk1 Csbp1 Csbp2 Mitogen-activated protein kinase p38 alpha CRK1 protein protein mouse Mus musculus Mouse MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES DIP protein P47811 original sequence version: 162 DIP protein P47811 original sequence version: 127 DIP protein P47811 original sequence version: 173 DFB03EBCE97BB51A stk11_human Serine/threonine-protein kinase STK11 STK11 LKB1 PJS Liver kinase B1 Renal carcinoma antigen NY-REN-19 protein protein human Homo sapiens Human MEVVDPQQLGMFTEGELMSVGMDTFIHRIDSTEVIYQPRRKRAKLIGKYLMGDLLGEGSYGKVKEVLDSETLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHKNVIQLVDVLYNEEKQKMYMVMEYCVCGMQEMLDSVPEKRFPVCQAHGYFCQLIDGLEYLHSQGIVHKDIKPGNLLLTTGGTLKISDLGVAEALHPFAADDTCRTSQGSPAFQPPEIANGLDTFSGFKVDIWSAGVTLYNITTGLYPFEGDNIYKLFENIGKGSYAIPGDCGPPLSDLLKGMLEYEPAKRFSIRQIRQHSWFRKKHPPAEAPVPIPPSPDTKDRWRSMTVVPYLEDLHGADEDEDLFDIEDDIIYTQDFTVPGQVPEEEASHNGQRRGLPKAVCMNGTEAAQLSTKSRAEGRAPNPARKACSASSKIRRLSACKQQ DIP protein Q15831 original sequence version: 117 DIP protein Q15831 original sequence version: 154 DIP protein Q15831 original sequence version: 174 DIP protein Q15831 original sequence version: 168 6DF4C37AB7A89569 tf65_mouse Transcription factor p65 Nuclear factor NF-kappa-B p65 subunit Rela Nfkb3 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3 protein protein mouse Mus musculus Mouse MDDLFPLIFPSEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGYYEADLCPDRSIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFHVPIEEQRGDYDLNAVRLCFQVTVRDPAGRPLLLTPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEEKRKRTYETFKSIMKKSPFNGPTEPRPPTRRIAVPTRNSTSVPKPAPQPYTFPASLSTINFDEFSPMLLPSGQISNQALALAPSSAPVLAQTMVPSSAMVPLAQPPAPAPVLTPGPPQSLSAPVPKSTQAGEGTLSEALLHLQFDADEDLGALLGNSTDPGVFTDLASVDNSEFQQLLNQGVSMSHSTAEPMLMEYPEAITRLVTGSQRPPDPAPTPLGTSGLPNGLSGDEDFSSIADMDFSALLSQISS DIP protein Q04207 original sequence version: 158 DIP protein Q04207 original sequence version: 117 DIP protein Q04207-1 original sequence version: 117 DIP protein Q04207-1 original sequence version: 118 DIP protein Q04207 original sequence version: 119 DIP protein Q04207 original sequence version: 141 DIP protein Q04207-1 original sequence version: 141 DIP protein Q04207-1 original sequence version: 149 DIP protein Q04207 original sequence version: 149 DIP protein Q04207 original sequence version: 168 DIP protein Q04207 original sequence version: 125 BDF1673D2FE398B9 nr4a1_mouse Nuclear receptor subfamily 4 group A member 1 Nr4a1 Gfrp Hmr N10 Nur77 Nuclear hormone receptor NUR/77 Nuclear protein N10 Orphan nuclear receptor HMR protein protein mouse Mus musculus Mouse MPCIQAQYGTPATSPGPRDHLTGDPLALEFGKPTMDLASPETAPAAPATLPSFSTFMDGYTGEFDTFLYQLPGTTQPCSSACSSASSTSSSSSSATSPASASFKFEDFQVYGCYPGTLSGPLDETLSSSGSEYYGSPCSAPSPSTPNFQPSQLSPWDGSFGHFSPSQTYEGLWAWTEQLPKASSGPPPPPTFFSFSPPTGPSPSLAQSSLKLFPPPATHQLGEGESYSMPAAFPGLAPTSPNRDTSGILDAPVTSTKSRSGASGGSEGRCAVCGDNASCQHYGVRTCEGCKGFFKRTVQKSAKYICLANKDCPVDKRRRNRCQFCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKQPPDASPTNLLTSLIRAHLDSGPSTAKLDYSKFQELVLPRFGKEDAGDVQQFYDLLSGSLDVIRKWAEKIPGFIELCPGDQDLLLESAFLELFILRLAYRSKPGEGKLIFCSGLVLHQLQCARGFGDWIDNILAFSRSLHSLGVDVPAFACLSALVLITDRHGLQDPRRVEELQNRIASCLKEHMATVAGDPQPASCLSRLLGKLPELRTLCTQGLQRIFCLKLEDLVPPPPIVDKIFMDTLSF DIP protein P12813 original sequence version: 150 8CFF45B58253887B tf65_human Transcription factor p65 Nuclear factor NF-kappa-B p65 subunit RELA NFKB3 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3 protein protein human Homo sapiens Human MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEEKRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRSSASVPKPAPQPYPFTSSLSTINYDEFPTMVFPSGQISQASALAPAPPQVLPQAPAPAPAPAMVSALAQAPAPVPVLAPGPPQAVAPPAPKPTQAGEGTLSEALLQLQFDDEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQGIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQISS DIP protein Q04206 original sequence version: 170 DIP protein Q04206 original sequence version: 173 DIP protein Q04206 original sequence version: 99 DIP protein Q04206-1 original sequence version: 99 DIP protein Q04206 original sequence version: 168 DIP protein Q04206 original sequence version: 128 DIP protein Q04206 original sequence version: 131 DIP protein Q04206 original sequence version: 153 DIP protein Q04206 original sequence version: 185 DIP protein Q04206 original sequence version: 181 DIP protein Q04206 original sequence version: 183 8147A6AF9F2445C6 p22736-1 Nuclear receptor subfamily 4 group A member 1 NR4A1 GFRP1 HMR NAK1 Early response protein NAK1 Nuclear hormone receptor NUR/77 Orphan nuclear receptor HMR Orphan nuclear receptor TR3 ST-59 Testicular receptor 3 protein protein human Homo sapiens Human MPCIQAQYGTPAPSPGPRDHLASDPLTPEFIKPTMDLASPEAAPAAPTALPSFSTFMDGYTGEFDTFLYQLPGTVQPCSSASSSASSTSSSSATSPASASFKFEDFQVYGCYPGPLSGPVDEALSSSGSDYYGSPCSAPSPSTPSFQPPQLSPWDGSFGHFSPSQTYEGLRAWTEQLPKASGPPQPPAFFSFSPPTGPSPSLAQSPLKLFPSQATHQLGEGESYSMPTAFPGLAPTSPHLEGSGILDTPVTSTKARSGAPGGSEGRCAVCGDNASCQHYGVRTCEGCKGFFKRTVQKNAKYICLANKDCPVDKRRRNRCQFCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKQPPDASPANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHFGKEDAGDVQQFYDLLSGSLEVIRKWAEKIPGFAELSPADQDLLLESAFLELFILRLAYRSKPGEGKLIFCSGLVLHRLQCARGFGDWIDSILAFSRSLHSLLVDVPAFACLSALVLITDRHGLQEPRRVEELQNRIASCLKEHVAAVAGEPQPASCLSRLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPPIIDKIFMDTLPF DIP protein P22736-1 original sequence version: 156 DIP protein P22736-1 original sequence version: 169 q16539-1 Mitogen-activated protein kinase 14 MAPK14 CSBP CSBP1 CSBP2 CSPB1 MXI2 SAPK2A Cytokine suppressive anti-inflammatory drug-binding protein MAP kinase MXI2 MAX-interacting protein 2 Mitogen-activated protein kinase p38 alpha Stress-activated protein kinase 2a protein protein human Homo sapiens Human MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES DIP protein Q16539-1 original sequence version: 169 DIP protein Q16539 original sequence version: 138 DIP protein Q16539 original sequence version: 187 nr4a1-mapk14-1 8 14 unspecified role unspecified role prey prey mouse Mus musculus Mouse 12 unspecified role unspecified role prey prey mouse Mus musculus Mouse 15 unspecified role unspecified role bait bait mouse Mus musculus Mouse association association stk11-nr4a1-1 10 13 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 17 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Region 377-598 Region 377-598 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction nr4a1-rela-1 11 16 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 17 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli direct interaction direct interaction nr4a1-mapk14-2 9 18 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 17 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli direct interaction direct interaction mapk14-nr4a1-1 2 18 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 17 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human physical association physical association nr4a1-rela-2 1 14 unspecified role unspecified role prey prey mouse Mus musculus Mouse 15 unspecified role unspecified role bait bait mouse Mus musculus Mouse physical association physical association nr4a1-rela-3 4 17 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Region 377-598 Region 377-598 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Region 1-265 Region 1-265 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 16 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association rela-nr4a1-1 6 17 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human 16 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association mapk14-nr4a1-2 3 18 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli 17 enzyme target enzyme target substrate substrate unspecified role unspecified role pThr pThr opthr O-phospho-L-threonine (2S,3R)-2-amino-3-(phosphonooxy)butanoic acid 2-amino-3-hydroxybutanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)butanoic acid MOD_RES Phosphothreonine O-phospho-L-threonine O-phosphorylated L-threonine O3-phosphothreonine threonine phosphate ester OPThr Phospho Phospho Threonyl Phosphorylation phosphorylationt western blot western blot Immuno blot Immuno blot undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined resulting-ptm resulting-ptm resulting ptm resulting-ptm ecolx Escherichia coli phosphorylation phosphorylation reaction phosphorylation mapk14-nr4a1-3 5 18 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 17 unspecified role unspecified role prey prey P22736-1:p.Pro597Trp P597W mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain P W This feature has been corrected as a result of our quality control procedures. The original label was 'P597W'. Wed May 02 15:11:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro597trp' Tue Jun 30 20:14:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro597Trp' P22736-1:p.His516Trp H516W mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain H W This feature has been corrected as a result of our quality control procedures. The original label was 'H516W'. Wed May 02 20:25:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his516trp' Tue Jun 30 15:51:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His516Trp' His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Region 377-598 Region 377-598 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction mapk14-nr4a1-4 7 18 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 17 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Region 377-598 Region 377-598 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human physical association physical association