DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Cellular energy stress induces AMPK-mediated regulation of YAP and the Hippo pathway. Cellular energy stress induces AMPK-mediated regulation of YAP and the Hippo pathway. Nature cell biology 2015 imex curation Mo JS., Meng Z., Kim YC., Park HW., Hansen CG., Kim S., Lim DS., Guan KL. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Mo JS., Meng Z., Kim YC., Park HW., Hansen CG., Kim S., Lim DS., Guan KL. DIP original experiment: DIP-266150X Nature cell biology 2015 IMEx Cellular energy stress induces AMPK-mediated regulation of YAP and the Hippo pathway. Cellular energy stress induces AMPK-mediated regulation of YAP and the Hippo pathway. Cellular energy stress induces AMPK-mediated regulation of YAP and the Hippo pathway. Nature cell biology 2015 imex curation Mo JS., Meng Z., Kim YC., Park HW., Hansen CG., Kim S., Lim DS., Guan KL. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Mo JS., Meng Z., Kim YC., Park HW., Hansen CG., Kim S., Lim DS., Guan KL. DIP original experiment: DIP-266152X Nature cell biology 2015 IMEx Cellular energy stress induces AMPK-mediated regulation of YAP and the Hippo pathway. Cellular energy stress induces AMPK-mediated regulation of YAP and the Hippo pathway. Cellular energy stress induces AMPK-mediated regulation of YAP and the Hippo pathway. Nature cell biology 2015 imex curation Mo JS., Meng Z., Kim YC., Park HW., Hansen CG., Kim S., Lim DS., Guan KL. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Mo JS., Meng Z., Kim YC., Park HW., Hansen CG., Kim S., Lim DS., Guan KL. DIP original experiment: DIP-266153X Nature cell biology 2015 IMEx Cellular energy stress induces AMPK-mediated regulation of YAP and the Hippo pathway. Cellular energy stress induces AMPK-mediated regulation of YAP and the Hippo pathway. Cellular energy stress induces AMPK-mediated regulation of YAP and the Hippo pathway. Nature cell biology 2015 imex curation Mo JS., Meng Z., Kim YC., Park HW., Hansen CG., Kim S., Lim DS., Guan KL. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Mo JS., Meng Z., Kim YC., Park HW., Hansen CG., Kim S., Lim DS., Guan KL. DIP original experiment: DIP-266149X Nature cell biology 2015 IMEx Cellular energy stress induces AMPK-mediated regulation of YAP and the Hippo pathway. Cellular energy stress induces AMPK-mediated regulation of YAP and the Hippo pathway. Cellular energy stress induces AMPK-mediated regulation of YAP and the Hippo pathway. Nature cell biology 2015 imex curation Mo JS., Meng Z., Kim YC., Park HW., Hansen CG., Kim S., Lim DS., Guan KL. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Mo JS., Meng Z., Kim YC., Park HW., Hansen CG., Kim S., Lim DS., Guan KL. DIP original experiment: DIP-266151X Nature cell biology 2015 IMEx Cellular energy stress induces AMPK-mediated regulation of YAP and the Hippo pathway. Cellular energy stress induces AMPK-mediated regulation of YAP and the Hippo pathway. Cellular energy stress induces AMPK-mediated regulation of YAP and the Hippo pathway. Nature cell biology 2015 imex curation Mo JS., Meng Z., Kim YC., Park HW., Hansen CG., Kim S., Lim DS., Guan KL. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Mo JS., Meng Z., Kim YC., Park HW., Hansen CG., Kim S., Lim DS., Guan KL. DIP original experiment: DIP-266147X Nature cell biology 2015 IMEx Cellular energy stress induces AMPK-mediated regulation of YAP and the Hippo pathway. Cellular energy stress induces AMPK-mediated regulation of YAP and the Hippo pathway. Cellular energy stress induces AMPK-mediated regulation of YAP and the Hippo pathway. Nature cell biology 2015 imex curation Mo JS., Meng Z., Kim YC., Park HW., Hansen CG., Kim S., Lim DS., Guan KL. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Mo JS., Meng Z., Kim YC., Park HW., Hansen CG., Kim S., Lim DS., Guan KL. DIP original experiment: DIP-266148X Nature cell biology 2015 IMEx Cellular energy stress induces AMPK-mediated regulation of YAP and the Hippo pathway. yap1_human Transcriptional coactivator YAP1 YAP1 YAP65 Protein yorkie homolog Yes-associated protein YAP65 homolog protein protein human Homo sapiens Human MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESFLTWL DIP protein P46937 original sequence version: 143 DIP protein P46937 original sequence version: 98 DIP protein P46937-1 original sequence version: 110 DIP protein P46937 original sequence version: 149 DIP protein P46937 original sequence version: 153 DIP protein P46937 original sequence version: 157 DIP protein P46937 original sequence version: 160 DIP protein P46937 original sequence version: 122 DIP protein P46937 original sequence version: 124 6145F7049ED338AE aapk1_human 5'-AMP-activated protein kinase catalytic subunit alpha-1 PRKAA1 AMPK1 Tau-protein kinase PRKAA1 Acetyl-CoA carboxylase kinase Hydroxymethylglutaryl-CoA reductase kinase protein protein human Homo sapiens Human MRRLSSWRKMATAEKQKHDGRVKIGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILNRQKIRSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPSDIFMVMEYVSGGELFDYICKNGRLDEKESRRLFQQILSGVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNYAAPEVISGRLYAGPEVDIWSSGVILYALLCGTLPFDDDHVPTLFKKICDGIFYTPQYLNPSVISLLKHMLQVDPMKRATIKDIREHEWFKQDLPKYLFPEDPSYSSTMIDDEALKEVCEKFECSEEEVLSCLYNRNHQDPLAVAYHLIIDNRRIMNEAKDFYLATSPPDSFLDDHHLTRPHPERVPFLVAETPRARHTLDELNPQKSKHQGVRKAKWHLGIRSQSRPNDIMAEVCRAIKQLDYEWKVVNPYYLRVRRKNPVTSTYSKMSLQLYQVDSRTYLLDFRSIDDEITEAKSGTATPQRSGSVSNYRSCQRSDSDAEAQGKSSEVSLTSSVTSLDSSPVDLTPRPGSHTIEFFEMCANLIKILAQ DIP protein Q13131 original sequence version: 149 DIP protein Q13131 original sequence version: 91 DIP protein Q13131 original sequence version: 165 DIP protein Q13131 original sequence version: 164 ABAE71FBF912947A runx2_human Runt-related transcription factor 2 Oncogene AML-3 Polyomavirus enhancer-binding protein 2 alpha A subunit SL3-3 enhancer factor 1 alpha A subunit SL3/AKV core-binding factor alpha A subunit Osteoblast-specific transcription factor 2 Core-binding factor subunit alpha-1 Acute myeloid leukemia 3 protein RUNX2 AML3 CBFA1 OSF2 PEBP2A protein protein human Homo sapiens Human MASNSLFSTVTPCQQNFFWDPSTSRRFSPPSSSLQPGKMSDVSPVVAAQQQQQQQQQQQQQQQQQQQQQQQEAAAAAAAAAAAAAAAAAVPRLRPPHDNRTMVEIIADHPAELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGEVPDGTVVTVMAGNDENYSAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKVTVDGPREPRRHRQKLDDSKPSLFSDRLSDLGRIPHPSMRVGVPPQNPRPSLNSAPSPFNPQGQSQITDPRQAQSSPPWSYDQSYPSYLSQMTSPSIHSTTPLSSTRGTGLPAITDVPRRISDDDTATSDFCLWPSTLSKKSQAGASELGPFSDPRQFPSISSLTESRFSNPRMHYPATFTYTPPVTSGMSLGMSATTHYHTYLPPPYPGSSQSQSGPFQTSSTPYLYYGTSSGSYQFPMVPGGDRSPSRMLPPCTTTSNGSTLLNPNLPNQNDGVDADGSHSSSPTVLNSSGRMDESVWRPY DIP protein Q13950 original sequence version: 155 DIP protein Q13950 original sequence version: 138 DIP protein Q13950 original sequence version: 108 DIP protein Q13950 original sequence version: 157 DIP protein Q13950 original sequence version: 135 DIP protein Q13950-1 original sequence version: 135 44C4F3867D6F3EB1 tead4_human Transcriptional enhancer factor TEF-3 TEAD4 RTEF1 TCF13L1 TEF3 TEA domain family member 4 Transcription factor RTEF-1 Transcription factor 13-like 1 protein protein human Homo sapiens Human MEGTAGTITSNEWSSPTSPEGSTASGGSQALDKPIDNDAEGVWSPDIEQSFQEALAIYPPCGRRKIILSDEGKMYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKAREIQAKLKDQAAKDKALQSMAAMSSAQIISATAFHSSMALARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTYAVQPPLPLPGFESPAGPAPSPSAPPAPPWQGRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFPEKKGGLKDLFERGPSNAFFLVKFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYSYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE DIP protein Q15561 original sequence version: 131 DIP protein Q15561-1 original sequence version: 138 544DDFD86E88D9A8 tead1_human Transcriptional enhancer factor TEF-1 TEA domain family member 1 Protein GT-IIC Transcription factor 13 NTEF-1 TEAD1 TCF13 TEF1 protein protein human Homo sapiens Human MEPSSWSGSESPAENMERMSDSADKPIDNDAEGVWSPDIEQSFQEALAIYPPCGRRKIILSDEGKMYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKSRDFHSKLKDQTAKDKALQHMAAMSSAQIVSATAIHNKLGLPGIPRPTFPGAPGFWPGMIQTGQPGSSQDVKPFVQQAYPIQPAVTAPIPGFEPASAPAPSVPAWQGRSIGTTKLRLVEFSAFLEQQRDPDSYNKHLFVHIGHANHSYSDPLLESVDIRQIYDKFPEKKGGLKELFGKGPQNAFFLVKFWADLNCNIQDDAGAFYGVTSQYESSENMTVTCSTKVCSFGKQVVEKVETEYARFENGRFVYRINRSPMCEYMINFIHKLKHLPEKYMMNSVLENFTILLVVTNRDTQETLLCMACVFEVSNSEHGAQHHIYRLVKD DIP protein P28347 original sequence version: 152 DIP protein P28347 original sequence version: 155 EFD8067F2770B3C7 yap1_mouse Transcriptional coactivator YAP1 Yap1 Yap Yap65 Protein yorkie homolog Yes-associated protein YAP65 homolog protein protein mouse Mus musculus Mouse MEPAQQPPPQPAPQGPAPPSVSPAGTPAAPPAPPAGHQVVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTASGVVSGPAAAPAAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHNDQTTTWQDPRKAMLSQLNVPAPASPAVPQTLMNSASGPLPDGWEQAMTQDGEVYYINHKNKTTSWLDPRLDPRFAMNQRITQSAPVKQPPPLAPQSPQGGVLGGGSSNQQQQIQLQQLQMEKERLRLKQQELFRQAIRNINPSTANAPKCQELALRSQLPTLEQDGGTPNAVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSIPRTPDDFLNSVDEMDTGDTISQSTLPSQQSRFPDYLEALPGTNVDLGTLEGDAMNIEGEELMPSLQEALSSEILDVESVLAATKLDKESFLTWL DIP protein P46938 original sequence version: 120 DIP protein P46938 original sequence version: 124 DIP protein P46938 original sequence version: 137 DIP protein P46938 original sequence version: 101 5A2221B74B1400F9 tead1_mouse Transcriptional enhancer factor TEF-1 Tead1 Tcf13 Tef-1 Tef1 NTEF-1 Protein GT-IIC TEA domain family member 1 Transcription factor 13 protein protein mouse Mus musculus Mouse MEPSSWSGSESPAENMERMSDSADKPIDNDAEGVWSPDIEQSFQEALAIYPPCGRRKIILSDEGKMYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKSRDFHSKLKDQTAKDKALQHMAAMSSAQIVSATAIHNKLGLPGIPRPTFPGGPGFWPGMIQTGQPGSSQDVKPFVQQAYPIQPAVTAPIPGFEPTSAPAPSVPAWQGRSIGTTKLRLVEFSAFLEQQRDPDSYNKHLFVHIGHANHSYSDPLLESVDIRQIYDKFPEKKGGLKELFGKGPQNAFFLVKFWADLNCNIQDDAGAFYGVSSQYESSENMTVTCSTKVCSFGKQVVEKVETEYARFENGRFVYRINRSPMCEYMINFIHKLKHLPEKYMMNSVLENFTILLVVTNRDTQETLLCMACVFEVSNSEHGAQHHIYRLVKD DIP protein P30051 original sequence version: 121 DIP protein P30051 original sequence version: 103 yap1-tead1-5 6 12 unspecified role unspecified role prey prey human Homo sapiens Human 8 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association yap1-prkaa1-2 1 9 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 8 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association runx2-yap1-1 2 10 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 8 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association yap1-tead1-6 7 14 unspecified role unspecified role prey prey mouse Mus musculus Mouse 13 unspecified role unspecified role bait bait mouse Mus musculus Mouse physical association physical association prkaa1-yap1-2 5 9 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 8 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association yap1-tead1-7 4 12 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 8 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association tead4-yap1-1 3 11 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 8 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range P46937:p.Ser94Ala S94A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain S A This feature has been corrected as a result of our quality control procedures. The original label was 'S94A'. Wed May 02 19:46:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser94ala' Tue Jun 30 18:05:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser94Ala' P46937:p.Ser94Glu S94E mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain S E This feature has been corrected as a result of our quality control procedures. The original label was 'S94E'. Wed May 02 19:04:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser94glu' Tue Jun 30 19:13:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser94Glu' human Homo sapiens Human physical association physical association