DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Kinetochore-microtubule error correction is driven by differentially regulated interaction modes. Kinetochore-microtubule error correction is driven by differentially regulated interaction modes. Nature cell biology 2015 imex curation Kalantzaki M., Kitamura E., Zhang T., Mino A., Novák B., Tanaka TU. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Kalantzaki M., Kitamura E., Zhang T., Mino A., Novák B., Tanaka TU. DIP original experiment: DIP-266138X Nature cell biology 2015 IMEx Kinetochore-microtubule error correction is driven by differentially regulated interaction modes. Kinetochore-microtubule error correction is driven by differentially regulated interaction modes. Kinetochore-microtubule error correction is driven by differentially regulated interaction modes. Nature cell biology 2015 imex curation Kalantzaki M., Kitamura E., Zhang T., Mino A., Novák B., Tanaka TU. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Kalantzaki M., Kitamura E., Zhang T., Mino A., Novák B., Tanaka TU. DIP original experiment: DIP-266140X Nature cell biology 2015 IMEx Kinetochore-microtubule error correction is driven by differentially regulated interaction modes. Kinetochore-microtubule error correction is driven by differentially regulated interaction modes. Kinetochore-microtubule error correction is driven by differentially regulated interaction modes. Nature cell biology 2015 imex curation Kalantzaki M., Kitamura E., Zhang T., Mino A., Novák B., Tanaka TU. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Kalantzaki M., Kitamura E., Zhang T., Mino A., Novák B., Tanaka TU. DIP original experiment: DIP-266139X Nature cell biology 2015 IMEx Kinetochore-microtubule error correction is driven by differentially regulated interaction modes. Kinetochore-microtubule error correction is driven by differentially regulated interaction modes. Kinetochore-microtubule error correction is driven by differentially regulated interaction modes. Nature cell biology 2015 imex curation Kalantzaki M., Kitamura E., Zhang T., Mino A., Novák B., Tanaka TU. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Kalantzaki M., Kitamura E., Zhang T., Mino A., Novák B., Tanaka TU. DIP original experiment: DIP-266141X Nature cell biology 2015 IMEx Kinetochore-microtubule error correction is driven by differentially regulated interaction modes. dam1_yeast DASH complex subunit DAM1 YGR113W G6153 DAM1 Outer kinetochore protein DAM1 DUO1 and MPS1-interacting protein 1 Kinetochore assembly protein DAM1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSEDKAKLGTTRSATEYRLSIGSAPTSRRSSMGESSSLMKFADQEGLTSSVGEYNENTIQQLLLPKIRELSDSIITLDSNFTRLNFIHESLADLNESLGSLLYGIMSNSWCVEFSQAPHDIQDDLIAIKQLKSLEDEKNNLVMELSNMERGIKRKKDEQGENDLAKASQNKQFNQPLFPSSQVRKYRSYDNRDKRKPSKIGNNLQVENEEDYEDDTSSEASFVLNPTNIGMSKSSQGHVTKTTRLNNNTNSKLRRKSILHTIRNSIASGADLPIENDNVVNLGDLHPNNRISLGSGAARVVNGPVTKNRNSMFSGRAERKPTESRHSVAKKTEKKINTRPPFR F02DB6EE09BC2284 F02DB6EE09BC2284 stu2_yeast Protein STU2 STU2 YLR045C L2108 Suppressor of tubulin 2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSGEEEVDYTTLPLEERLTYKLWKARLEAYKELNQLFRNSVGDISRDDNIQIYWRDPTLFAQYITDSNVVAQEQAIVALNSLIDAFASSSLKNAHNITLISTWTPLLVEKGLTSSRATTKTQSMSCILSLCGLDTSITQSVELVIPFFEKKLPKLIAAAANCVYELMAAFGLTNVNVQTFLPELLKHVPQLAGHGDRNVRSQTMNLIVEIYKVTGNNSDLLEEILFKKLKPIQVKDLHKLFAKVGDEPSSSKMLFEWEKRELEKKRSQEEEARKRKSILSNDEGEYQIDKDGDTLMGMETDMPPSKQQSGVQIDTFSMLPEETILDKLPKDFQERITSSKWKDRVEALEEFWDSVLSQTKKLKSTSQNYSNLLGIYGHIIQKDANIQAVALAAQSVELICDKLKTPGFSKDYVSLVFTPLLDRTKEKKPSVIEAIRKALLTICKYYDPLASSGRNEDMLKDILEHMKHKTPQIRMECTQLFNASMKEEKDGYSTLQRYLKDEVVPIVIQIVNDTQPAIRTIGFESFAILIKIFGMNTFVKTLEHLDNLKRKKIEETVKTLPNFSIASGSTHSTIETNKQTGPMENKFLLKKSSVLPSKRVASSPLRNDNKSKVNPIGSVASASKPSMVAANNKSRVLLTSKSLATPKNVVANSTDKNEKLIEEYKYRLQKLQNDEMIWTKERQSLLEKMNNTENYKIEMIKENEMLREQLKEAQSKLNEKNIQLRSKEIDVNKLSDRVLSLENELRNMEIELDRNKKRNDTNLQSMGTISSYSIPSSTVSSNYGVKSLSSALPFKEEEDVRRKEDVNYERRSSESIGDLPHRVNSLNIRPYRKNGTGVSSVSDDLDIDFNDSFASEESYKRAAAVTSTLKARIEKMKAKSRREGTTRT 7A49C3702E21C7BF 7A49C3702E21C7BF duo1_yeast DASH complex subunit DUO1 YGL061C DUO1 Outer kinetochore protein DUO1 Death upon overproduction protein 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSEQSQLDDSTIDKLIPQIFNEMRSNLNNTTNKFPKSTGGGASDNISANSNSIRSFNSITTQSLLKESESLDKITAMIKNVTAALKNNLPVYVNQVHEVCKSTNSILDSWINIHSQAGYIHKLMSDQTYLKLINDRLHNENVNTNDEDGSTLHNVIALKKKEILDLRQKLENRKGEKDAAPAKPPNQGLNPRYGVQSGRRPVPSAGISNNGRVRKTHVPASKRPSGIPRVTNRWTKPTASSSRKMFR 787F8AF869E3C978 787F8AF869E3C978 ndc80_yeast Kinetochore protein NDC80 NDC80 80 kDa spindle component protein HEC1 Nuclear division cycle protein 80 TID3 Two-hybrid interaction with DMC1 protein 3 YIL144W protein protein yeast Saccharomyces cerevisiae Baker's yeast MQSSTSTDQHVLHHMDPHRFTSQIPTATSSQLRRRNSTNQGLTDMINKSIARNTISGTGIPTGGINKNKRTRSTVAGGTNGTALALNDKSNSRNSVSRLSINQLGSLQQHLSNRDPRPLRDKNFQSAIQEEIYDYLKKNKFDIETNHPISIKFLKQPTQKGFIIIFKWLYLRLDPGYGFTKSIENEIYQILKNLRYPFLESINKSQISAVGGSNWHKFLGMLHWMVRTNIKLDMCLNKVDRSLINQNTQEITILSQPLKTLDEQDQRQERYELMVEKLLIDYFTESYKSFLKLEDNYEPSMQELKLGFEKFVHIINTDIANLQTQNDNLYEKYQEVMKISQKIKTTREKWKALKSDSNKYENYVNAMKQKSQEWPGKLEKMKSECELKEEEIKALQSNISELHKILRKKGISTEQFELQNQEREKLTRELDKINIQSDKLTSSIKSRKLEAEGIFKSLLDTLRQYDSSIQNLTRSRSQLGHNVNDSSLKINISENLLDRDFHEGISYEQLFPKGSGINESIKKSILKLNDEIQERIKTIEKDNITLEKDIKNLKHDINEKTQINEKLELELSEANSKFELSKQENERLLVAQRIEIEKMEKKINDSNLLMKTKISDAEELVTSTELKLEELKVDLNRKRYKLHQQVIHVIDITSKFKINIQSSLENSENELGNVIEELRNLEFETEHNVTN 7DBC492227A80093 7DBC492227A80093 stu2-dam1-1 2 6 unspecified role unspecified role bait bait Region 550-888 Region 550-888 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 5 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association ndc80-dam1-1 1 8 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 5 unspecified role unspecified role prey prey P53267:p.[Ser257Asp;Ser265Asp;Ser292Asp;Ser327Asp] S257D/S265D/S292D/S327D mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain S D certain certain sequence position certain certain certain sequence position certain S D certain certain sequence position certain certain certain sequence position certain S D certain certain sequence position certain certain certain sequence position certain S D This feature has been corrected as a result of our quality control procedures. The original label was 'S257D/S265D/S292D/S327D'. Wed May 02 20:07:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser257asp,ser265asp,ser292asp,ser327asp' Tue Jun 30 19:10:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser257Asp;Ser265Asp;Ser292Asp;Ser327Asp]' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association Deletion of region 206-343 decreased the interaction rate/strength. duo1-dam1-1 4 7 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 5 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association stu2-dam1-2 3 6 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 5 unspecified role unspecified role prey prey P53267:p.[Ser257Asp;Ser265Asp;Ser292Asp;Ser327Asp] S257D/S265D/S292D/S327D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain S D certain certain sequence position certain certain certain sequence position certain S D certain certain sequence position certain certain certain sequence position certain S D certain certain sequence position certain certain certain sequence position certain S D This feature has been corrected as a result of our quality control procedures. The original label was 'S257D/S265D/S292D/S327D'. Wed May 02 17:55:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser257asp,ser265asp,ser292asp,ser327asp' Tue Jun 30 17:22:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser257Asp;Ser265Asp;Ser292Asp;Ser327Asp]' Region 206-343 Region 206-343 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association