DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu ATG12-ATG3 interacts with Alix to promote basal autophagic flux and late endosome function. ATG12-ATG3 interacts with Alix to promote basal autophagic flux and late endosome function. Nature cell biology 2015 imex curation Murrow L., Malhotra R., Debnath J. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Murrow L., Malhotra R., Debnath J. DIP original experiment: DIP-266129X Nature cell biology 2015 IMEx ATG12-ATG3 interacts with Alix to promote basal autophagic flux and late endosome function. ATG12-ATG3 interacts with Alix to promote basal autophagic flux and late endosome function. ATG12-ATG3 interacts with Alix to promote basal autophagic flux and late endosome function. Nature cell biology 2015 imex curation Murrow L., Malhotra R., Debnath J. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Murrow L., Malhotra R., Debnath J. DIP original experiment: DIP-266124X Nature cell biology 2015 IMEx ATG12-ATG3 interacts with Alix to promote basal autophagic flux and late endosome function. ATG12-ATG3 interacts with Alix to promote basal autophagic flux and late endosome function. ATG12-ATG3 interacts with Alix to promote basal autophagic flux and late endosome function. Nature cell biology 2015 imex curation Murrow L., Malhotra R., Debnath J. Only protein-protein interactions mouse Mus musculus Mouse anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Murrow L., Malhotra R., Debnath J. DIP original experiment: DIP-266131X Nature cell biology 2015 IMEx ATG12-ATG3 interacts with Alix to promote basal autophagic flux and late endosome function. ATG12-ATG3 interacts with Alix to promote basal autophagic flux and late endosome function. ATG12-ATG3 interacts with Alix to promote basal autophagic flux and late endosome function. Nature cell biology 2015 imex curation Murrow L., Malhotra R., Debnath J. Only protein-protein interactions mouse Mus musculus Mouse anti tag coip anti tag coimmunoprecipitation anti tag coip de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence Murrow L., Malhotra R., Debnath J. DIP original experiment: DIP-266126X Nature cell biology 2015 IMEx ATG12-ATG3 interacts with Alix to promote basal autophagic flux and late endosome function. ATG12-ATG3 interacts with Alix to promote basal autophagic flux and late endosome function. ATG12-ATG3 interacts with Alix to promote basal autophagic flux and late endosome function. Nature cell biology 2015 imex curation Murrow L., Malhotra R., Debnath J. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Murrow L., Malhotra R., Debnath J. DIP original experiment: DIP-266128X Nature cell biology 2015 IMEx ATG12-ATG3 interacts with Alix to promote basal autophagic flux and late endosome function. ATG12-ATG3 interacts with Alix to promote basal autophagic flux and late endosome function. ATG12-ATG3 interacts with Alix to promote basal autophagic flux and late endosome function. Nature cell biology 2015 imex curation Murrow L., Malhotra R., Debnath J. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Murrow L., Malhotra R., Debnath J. DIP original experiment: DIP-266127X Nature cell biology 2015 IMEx ATG12-ATG3 interacts with Alix to promote basal autophagic flux and late endosome function. ATG12-ATG3 interacts with Alix to promote basal autophagic flux and late endosome function. ATG12-ATG3 interacts with Alix to promote basal autophagic flux and late endosome function. Nature cell biology 2015 imex curation Murrow L., Malhotra R., Debnath J. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Murrow L., Malhotra R., Debnath J. DIP original experiment: DIP-266130X Nature cell biology 2015 IMEx ATG12-ATG3 interacts with Alix to promote basal autophagic flux and late endosome function. ATG12-ATG3 interacts with Alix to promote basal autophagic flux and late endosome function. ATG12-ATG3 interacts with Alix to promote basal autophagic flux and late endosome function. Nature cell biology 2015 imex curation Murrow L., Malhotra R., Debnath J. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Murrow L., Malhotra R., Debnath J. DIP original experiment: DIP-266125X Nature cell biology 2015 IMEx ATG12-ATG3 interacts with Alix to promote basal autophagic flux and late endosome function. pdc6i_human Programmed cell death 6-interacting protein PDCD6IP AIP1 KIAA1375 ALIX ALG-2-interacting protein 1 Hp95 ALG-2-interacting protein X protein protein human Homo sapiens Human MATFISVQLKKTSEVDLAKPLVKFIQQTYPSGGEEQAQYCRAAEELSKLRRAAVGRPLDKHEGALETLLRYYDQICSIEPKFPFSENQICLTFTWKDAFDKGSLFGGSVKLALASLGYEKSCVLFNCAALASQIAAEQNLDNDEGLKIAAKHYQFASGAFLHIKETVLSALSREPTVDISPDTVGTLSLIMLAQAQEVFFLKATRDKMKDAIIAKLANQAADYFGDAFKQCQYKDTLPKEVFPVLAAKHCIMQANAEYHQSILAKQQKKFGEEIARLQHAAELIKTVASRYDEYVNVKDFSDKINRALAAAKKDNDFIYHDRVPDLKDLDPIGKATLVKSTPVNVPISQKFTDLFEKMVPVSVQQSLAAYNQRKADLVNRSIAQMREATTLANGVLASLNLPAAIEDVSGDTVPQSILTKSRSVIEQGGIQTVDQLIKELPELLQRNREILDESLRLLDEEEATDNDLRAKFKERWQRTPSNELYKPLRAEGTNFRTVLDKAVQADGQVKECYQSHRDTIVLLCKPEPELNAAIPSANPAKTMQGSEVVNVLKSLLSNLDEVKKEREGLENDLKSVNFDMTSKFLTALAQDGVINEEALSVTELDRVYGGLTTKVQESLKKQEGLLKNIQVSHQEFSKMKQSNNEANLREEVLKNLATAYDNFVELVANLKEGTKFYNELTEILVRFQNKCSDIVFARKTERDELLKDLQQSIAREPSAPSIPTPAYQSSPAGGHAPTPPTPAPRTMPPTKPQPPARPPPPVLPANRAPSATAPSPVGAGTAAPAPSQTPGSAPPPQAQGPPYPTYPGYPGYCQMPMPMGYNPYAYGQYNMPYPPVYHQSPGQAPYPGPQQPSYPFPQPPQQSYYPQQ DIP protein Q8WUM4 original sequence version: 46 DIP protein Q8WUM4 original sequence version: 67 DIP protein Q8WUM4 original sequence version: 60 DIP protein Q8WUM4 original sequence version: 64 DIP protein Q8WUM4 original sequence version: 66 DIP protein Q8WUM4 original sequence version: 89 DIP protein Q8WUM4 original sequence version: 100 DIP protein Q8WUM4-1 original sequence version: 145 DIP protein Q8WUM4-1 original sequence version: 137 DIP protein Q8WUM4-1 original sequence version: 138 DIP protein Q8WUM4 original sequence version: 138 DIP protein Q8WUM4 original sequence version: 106 573588D1F612EC93 chm4b_mouse Charged multivesicular body protein 4b Chmp4b Chromatin-modifying protein 4b protein protein mouse Mus musculus Mouse MSVFGKLFGAGGGKAGKGGPTPQEAIQRLRDTEEMLSKKQEFLEKKIEQELTAAKKHGTKNKRAALQALKRKKRYEKQLAQIDGTLSTIEFQREALENANTNTEVLKNMGYAAKAMKAAHDNMDIDKVDELMQDIADQQELAEEISTAISKPVGFGEEFDEDELMAELEELEQEELDKNLLEISGPETVPLPNVPSVALPSKPAKKKEEEDDDMKELENWAGSM DIP protein Q9D8B3 original sequence version: 110 mint Component of the ESCRT-III complex, which is required for multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. The MVB pathway mediates delivery of transmembrane proteins into the lumen of the lysosome for degradation. The ESCRT-III complex is probably involved in the concentration of MVB cargo. In the ESCRT-III complex, it probably serves as an acceptor for ESCRT-I complex on endosomal membranes DB1D79C3C9ECCB2F gag_mlvff Gag polyprotein gag Core polyprotein protein protein mlvff Friend murine leukemia virus (isolate FB29) FrMLV MGQAVTTPLSLTLDHWKDVERTAHNLSVEVRKRRWVTFCSAEWPTFNVGWPRDGTFNPDIITQVKIKVFSPGPHGHPDQVPYIVTWEAIAVDPPPWVRPFVHPKPPLSLPPSAPSLPPEPPLSTPPQSSLYPALTSPLNTKPRPQVLPDSGGPLIDLLTEDPPPYRDPGPPSPDGNGDSGEVAPTEGAPDPSPMVSRLRGRKEPPVADSTTSQAFPLRLGGNGQYQYWPFSSSDLYNWKNNNPSFSEDPAKLTALIESVLLTHQPTWDDCQQLLGTLLTGEEKQRVLLEARKAVRGEDGRPTQLPNDINDAFPLERPDWDYNTQRGRNHLVHYRQLLLAGLQNAGRSPTNLAKVKGITQGPNESPSAFLERLKEAYRRYTPYDPEDPGQETNVAMSFIWQSAPDIGRKLERLEDLKSKTLGDLVREAEKIFNKRETPEEREERIRRETEEKEERRRAEDVQREKERDRRRHREMSKLLATVVSGQRQDRQGGERRRPQLDHDQCAYCKEKGHWARDCPKKPRGPRGPRPQASLLTLDD DIP protein P26806 original sequence version: 109 atg3_mouse Ubiquitin-like-conjugating enzyme ATG3 Atg3 Apg3l Autophagy-related protein 3 protein protein mouse Mus musculus Mouse MQNVINTVKGKALEVAEYLTPVLKESKFKETGVITPEEFVAAGDHLVHHCPTWQWATGEELKVKAYLPTDKQFLVTKNVPCYKRCKQMEYSDELEAIIEEDDGDGGWVDTYHNTGITGITEAVKEITLESKDSIKLQDCSALCDEEDEEDEGEAADMEEYEESGLLETDEATLDTRKIVEACKAKADAGGEDAILQTRTYDLYITYDKYYQTPRLWLFGYDEQRQPLTVEHMYEDISQDHVKKTVTIENHPHLPPPPMCSVHPCRHAEVMKKIIETVAEGGGELGVHMYLLIFLKFVQAVIPTIEYDYTRHFTM DIP protein Q9CPX6 original sequence version: 72 DIP protein Q9CPX6 original sequence version: 92 EC5ECACD3247ED66 q9wu78-1 Programmed cell death 6-interacting protein Pdcd6ip Aip1 Alix ALG-2-interacting protein 1 ALG-2-interacting protein X E2F1-inducible protein Eig2 protein protein mouse Mus musculus Mouse MASFIWVQLKKTSEVDLAKPLVKFIQQTYPSGGEEQAQYCRAAEELSKLRRSALGRPLDKHEGALETLLRYYDQICSIEPKFPFSENQICLTFTWKDAFDKGSLFGGSVKLALASLGYEKSCVLFNCAALASQIAAEQNLDNDEGLKTAAKQYQFASGAFLHIKDTVLSALSREPTVDISPDTVGTLSLIMLAQAQEVFFLKATRDKMKDAIIAKLANQAADYFGDAFKQCQYKDTLPKEVFPTLAAKQCIMQANAEYHQSILAKQQKKFGEEIARLQHAAELIKNVASRYDEYVNVKDFSDKINRALTAAKKDNDFIYHDRVPDLKDLDPIGKATLVKPTPVNVPVSQKFTDLFEKMVPVSVQQSLAVFSQRKADLVNRSIAQMREATTLANGVLASLNLPAAIEDVSGDTVPQSILTKSTSVVEQGGIQTVDQLIKELPELLQRNREILEESLRLLDEEEATDNDLRAKFKDRWQRTPSNDLYKPLRAEGAKFRAVLDKAVQADGQVKERYQSHRDTIALLCKPEPELNAAIPSANPAKTMQGSEVVSVLKSLLSNLDEIKKERESLENDLKSVNFDMTSKFLTALAQDGVINEEALSVTELDRIYGGLTSKVQESLKKQEGLLKNIQVSHQEFSKMKQSNNEANLREEVLKNLATAYDNFVELVANLKEGTKFYNELTEILVRFQNKCSDIVFARKTERDELLKDLQQSIAREPSAPSIPPPAYQSSPAAGHAAAPPTPAPRTMPPAKPQPPARPPPPVLPANRVPPASAAAAPAGVGTASAAPPQTPGSAPPPQAQGPPYPTYPGYPGYCQMPMPMGYNPYAYGQYNMPYPPVYHQSPGQAPYPGPQQPTYPFPQPPQQSYYPQQ DIP protein Q9WU78-1 original sequence version: 72 DIP protein Q9WU78 original sequence version: 77 DIP protein Q9WU78 original sequence version: 115 atg12_mouse Ubiquitin-like protein ATG12 Atg12 Apg12 Apg12l Autophagy-related protein 12 protein protein mouse Mus musculus Mouse MSEDSEVVLQLPSAPVGAGGESLPELSPETATPEPPSSAAVSPGTEEPPGDTKKKIDILLKAVGDTPIMKTKKWAVERTRTIQGLIDFIKKFLKLVASEQLFIYVNQSFAPSPDQEVGTLYECFGSDGKLVLHYCKSQAWG DIP protein Q9CQY1 original sequence version: 111 440F9A625624A78B pdcd6ip-atg3-1 2 12 unspecified role unspecified role prey prey Q9CPX6:p.Lys243Arg K243R mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain K R This feature has been corrected as a result of our quality control procedures. The original label was 'K243R'. Wed May 02 16:54:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys243arg' Tue Jun 30 17:55:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys243Arg' HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 9 unspecified role unspecified role bait bait mCherry-tag mCherry-tag mcherry mcherry fluorescent protein tag mcherry n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association pdcd6ip-gag-4 7 11 unspecified role unspecified role prey prey YFP-tag YFP-tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 9 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association atg12-pdcd6ip-1 4 13 unspecified role unspecified role prey prey mouse Mus musculus Mouse 14 unspecified role unspecified role bait bait HA HA ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range mouse Mus musculus Mouse physical association physical association atg3-atg12-1 3 14 unspecified role unspecified role prey prey mouse Mus musculus Mouse 12 unspecified role unspecified role bait bait Q9CPX6:p.Lys243Arg K243R mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain K R This feature has been corrected as a result of our quality control procedures. The original label was 'K243R'. Wed May 02 14:42:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys243arg' Tue Jun 30 17:10:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys243Arg' V5-tag V5-tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range mouse Mus musculus Mouse physical association physical association atg12-pdcd6ip-2 6 13 unspecified role unspecified role prey prey mouse Mus musculus Mouse 14 unspecified role unspecified role bait bait mouse Mus musculus Mouse physical association physical association atg12-atg3-9 8 13 unspecified role unspecified role prey prey mouse Mus musculus Mouse 12 unspecified role unspecified role prey prey mouse Mus musculus Mouse 14 unspecified role unspecified role bait bait mouse Mus musculus Mouse association association pdcd6ip-chmp4b-2 1 10 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 9 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association pdcd6ip-atg12-1 5 14 unspecified role unspecified role prey prey YFP-tag YFP-tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 9 unspecified role unspecified role bait bait mCherry-tag mCherry-tag mcherry mcherry fluorescent protein tag mcherry n-term range n-terminal range n-term range n-term range n-terminal range n-term range Region 1-359 Region 1-359 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Region 360-702 Region 360-702 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human physical association physical association