DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structural basis for amyloidogenic peptide recognition by sorLA. Structural basis for amyloidogenic peptide recognition by sorLA. Nature structural & molecular biology 2015 imex curation Kitago Y., Nagae M., Nakata Z., Yagi-Utsumi M., Takagi-Niidome S., Mihara E., Nogi T., Kato K., Takagi J., Kitago Y., Nagae M., Nakata Z., Yagi-Utsumi M., Takagi-Niidome S., Mihara E., Nogi T., Kato K., Takagi J. Alzheimers - Interactions investigated in the context of Alzheimers disease Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Kitago Y., Nagae M., Nakata Z., Yagi-Utsumi M., Takagi-Niidome S., Mihara E., Nogi T., Kato K., Takagi J. Alzheimers - Interactions investigated in the context of Alzheimers disease DIP original experiment: DIP-265677X Nature structural & molecular biology 2015 IMEx Structural basis for amyloidogenic peptide recognition by sorLA. Structural basis for amyloidogenic peptide recognition by sorLA. Structural basis for amyloidogenic peptide recognition by sorLA. Nature structural & molecular biology 2015 imex curation Kitago Y., Nagae M., Nakata Z., Yagi-Utsumi M., Takagi-Niidome S., Mihara E., Nogi T., Kato K., Takagi J., Kitago Y., Nagae M., Nakata Z., Yagi-Utsumi M., Takagi-Niidome S., Mihara E., Nogi T., Kato K., Takagi J. Alzheimers - Interactions investigated in the context of Alzheimers disease Only protein-protein interactions in vitro In vitro fps fluorescence polarization spectroscopy Fluorescence anisotropy FPS FPS Fluorescence anisotropy fps predetermined predetermined participant predetermined Kitago Y., Nagae M., Nakata Z., Yagi-Utsumi M., Takagi-Niidome S., Mihara E., Nogi T., Kato K., Takagi J. Alzheimers - Interactions investigated in the context of Alzheimers disease DIP original experiment: DIP-265676X Nature structural & molecular biology 2015 IMEx Structural basis for amyloidogenic peptide recognition by sorLA. Structural basis for amyloidogenic peptide recognition by sorLA. Structural basis for amyloidogenic peptide recognition by sorLA. Nature structural & molecular biology 2015 imex curation Kitago Y., Nagae M., Nakata Z., Yagi-Utsumi M., Takagi-Niidome S., Mihara E., Nogi T., Kato K., Takagi J., Kitago Y., Nagae M., Nakata Z., Yagi-Utsumi M., Takagi-Niidome S., Mihara E., Nogi T., Kato K., Takagi J. Alzheimers - Interactions investigated in the context of Alzheimers disease Only protein-protein interactions in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Kitago Y., Nagae M., Nakata Z., Yagi-Utsumi M., Takagi-Niidome S., Mihara E., Nogi T., Kato K., Takagi J. Alzheimers - Interactions investigated in the context of Alzheimers disease DIP original experiment: DIP-265675X Nature structural & molecular biology 2015 IMEx Structural basis for amyloidogenic peptide recognition by sorLA. sorl_human Sortilin-related receptor Sorting protein-related receptor containing LDLR class A repeats SorLA-1 Low-density lipoprotein receptor relative with 11 ligand-binding repeats SORL1 C11orf32 protein protein human Homo sapiens Human MATRSSRRESRLPFLFTLVALLPPGALCEVWTQRLHGGSAPLPQDRGFLVVQGDPRELRLWARGDARGASRADEKPLRRKRSAALQPEPIKVYGQVSLNDSHNQMVVHWAGEKSNVIVALARDSLALARPKSSDVYVSYDYGKSFKKISDKLNFGLGNRSEAVIAQFYHSPADNKRYIFADAYAQYLWITFDFCNTLQGFSIPFRAADLLLHSKASNLLLGFDRSHPNKQLWKSDDFGQTWIMIQEHVKSFSWGIDPYDKPNTIYIERHEPSGYSTVFRSTDFFQSRENQEVILEEVRDFQLRDKYMFATKVVHLLGSEQQSSVQLWVSFGRKPMRAAQFVTRHPINEYYIADASEDQVFVCVSHSNNRTNLYISEAEGLKFSLSLENVLYYSPGGAGSDTLVRYFANEPFADFHRVEGLQGVYIATLINGSMNEENMRSVITFDKGGTWEFLQAPAFTGYGEKINCELSQGCSLHLAQRLSQLLNLQLRRMPILSKESAPGLIIATGSVGKNLASKTNVYISSSAGARWREALPGPHYYTWGDHGGIITAIAQGMETNELKYSTNEGETWKTFIFSEKPVFVYGLLTEPGEKSTVFTIFGSNKENVHSWLILQVNATDALGVPCTENDYKLWSPSDERGNECLLGHKTVFKRRTPHATCFNGEDFDRPVVVSNCSCTREDYECDFGFKMSEDLSLEVCVPDPEFSGKSYSPPVPCPVGSTYRRTRGYRKISGDTCSGGDVEARLEGELVPCPLAEENEFILYAVRKSIYRYDLASGATEQLPLTGLRAAVALDFDYEHNCLYWSDLALDVIQRLCLNGSTGQEVIINSGLETVEALAFEPLSQLLYWVDAGFKKIEVANPDGDFRLTIVNSSVLDRPRALVLVPQEGVMFWTDWGDLKPGIYRSNMDGSAAYHLVSEDVKWPNGISVDDQWIYWTDAYLECIERITFSGQQRSVILDNLPHPYAIAVFKNEIYWDDWSQLSIFRASKYSGSQMEILANQLTGLMDMKIFYKGKNTGSNACVPRPCSLLCLPKANNSRSCRCPEDVSSSVLPSGDLMCDCPQGYQLKNNTCVKQENTCLRNQYRCSNGNCINSIWWCDFDNDCGDMSDERNCPTTICDLDTQFRCQESGTCIPLSYKCDLEDDCGDNSDESHCEMHQCRSDEYNCSSGMCIRSSWVCDGDNDCRDWSDEANCTAIYHTCEASNFQCRNGHCIPQRWACDGDTDCQDGSDEDPVNCEKKCNGFRCPNGTCIPSSKHCDGLRDCSDGSDEQHCEPLCTHFMDFVCKNRQQCLFHSMVCDGIIQCRDGSDEDAAFAGCSQDPEFHKVCDEFGFQCQNGVCISLIWKCDGMDDCGDYSDEANCENPTEAPNCSRYFQFRCENGHCIPNRWKCDRENDCGDWSDEKDCGDSHILPFSTPGPSTCLPNYYRCSSGTCVMDTWVCDGYRDCADGSDEEACPLLANVTAASTPTQLGRCDRFEFECHQPKTCIPNWKRCDGHQDCQDGRDEANCPTHSTLTCMSREFQCEDGEACIVLSERCDGFLDCSDESDEKACSDELTVYKVQNLQWTADFSGDVTLTWMRPKKMPSASCVYNVYYRVVGESIWKTLETHSNKTNTVLKVLKPDTTYQVKVQVQCLSKAHNTNDFVTLRTPEGLPDAPRNLQLSLPREAEGVIVGHWAPPIHTHGLIREYIVEYSRSGSKMWASQRAASNFTEIKNLLVNTLYTVRVAAVTSRGIGNWSDSKSITTIKGKVIPPPDIHIDSYGENYLSFTLTMESDIKVNGYVVNLFWAFDTHKQERRTLNFRGSILSHKVGNLTAHTSYEISAWAKTDLGDSPLAFEHVMTRGVRPPAPSLKAKAINQTAVECTWTGPRNVVYGIFYATSFLDLYRNPKSLTTSLHNKTVIVSKDEQYLFLVRVVVPYQGPSSDYVVVKMIPDSRLPPRHLHVVHTGKTSVVIKWESPYDSPDQDLLYAVAVKDLIRKTDRSYKVKSRNSTVEYTLNKLEPGGKYHIIVQLGNMSKDSSIKITTVSLSAPDALKIITENDHVLLFWKSLALKEKHFNESRGYEIHMFDSAMNITAYLGNTTDNFFKISNLKMGHNYTFTVQARCLFGNQICGEPAILLYDELGSGADASATQAARSTDVAAVVVPILFLILLSLGVGFAILYTKHRRLQSSFTAFANSHYSSRLGSAIFSSGDDLGEDDEDAPMITGFSDDVPMVIA DIP protein Q92673 original sequence version: 154 4C215BB33E65C0B2 p05067-pro_0000000093 Amyloid-beta protein 40 APP A4 AD1 ABPP Alzheimer disease amyloid protein Cerebral vascular amyloid peptide PreA4 Protease nexin-II APPI Amyloid precursor protein Amyloid-beta A4 protein Alzheimer disease amyloid A4 protein homolog Amyloid-beta (A4) precursor protein protein protein human Homo sapiens Human DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV 672 711 D563D7858C3768F1 app-sorl1-1 3 5 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 4 unspecified role unspecified role unspecified role unspecified role Region 86-753 Region 86-753 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster direct interaction direct interaction app-sorl1-2 1 5 unspecified role unspecified role unspecified role unspecified role Region 6-15 Region 6-15 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 4 unspecified role unspecified role unspecified role unspecified role Region 86-753 Region 86-753 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster direct interaction direct interaction app-sorl1-3 2 5 unspecified role unspecified role unspecified role unspecified role Alexa488-label Alexa488-label alexa 488 label alexa 488 label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-16141261]N-terminal positions must always be 1. Actual positions : 0-0 [EBI-16141261]0-0 in vitro In vitro 4 unspecified role unspecified role unspecified role unspecified role Region 86-753 Region 86-753 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q92673:p.Gly511Arg G511R mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain G R This feature has been corrected as a result of our quality control procedures. The original label was 'G511R'. Wed May 02 17:15:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly511arg' Tue Jun 30 17:25:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly511Arg' Region 391-412 Region 391-412 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Region 481-493 Region 481-493 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human direct interaction direct interaction