DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Lipid vesicles trigger α-synuclein aggregation by stimulating primary nucleation. Lipid vesicles trigger α-synuclein aggregation by stimulating primary nucleation. Nature chemical biology 2015 imex curation Galvagnion C., Buell AK., Meisl G., Michaels TC., Vendruscolo M., Knowles TP., Dobson CM. Only protein-protein interactions in vitro In vitro atomic force microsc atomic force microscopy AFM AFM atomic force microsc predetermined predetermined participant predetermined Galvagnion C., Buell AK., Meisl G., Michaels TC., Vendruscolo M., Knowles TP., Dobson CM. DIP original experiment: DIP-266209X Nature chemical biology 2015 IMEx Lipid vesicles trigger α-synuclein aggregation by stimulating primary nucleation. Lipid vesicles trigger α-synuclein aggregation by stimulating primary nucleation. Lipid vesicles trigger α-synuclein aggregation by stimulating primary nucleation. Nature chemical biology 2015 imex curation Galvagnion C., Buell AK., Meisl G., Michaels TC., Vendruscolo M., Knowles TP., Dobson CM. Only protein-protein interactions in vitro In vitro fluorescence spectr classical fluorescence spectroscopy fluorescence spectr predetermined predetermined participant predetermined Galvagnion C., Buell AK., Meisl G., Michaels TC., Vendruscolo M., Knowles TP., Dobson CM. DIP original experiment: DIP-266208X Nature chemical biology 2015 IMEx Lipid vesicles trigger α-synuclein aggregation by stimulating primary nucleation. syua_human Alpha-synuclein Non-A beta component of AD amyloid Non-A4 component of amyloid precursor SNCA NACP PARK1 protein protein human Homo sapiens Human MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA DIP protein P37840 original sequence version: 124 DIP protein P37840 original sequence version: 175 DIP protein P37840 original sequence version: 178 6BB2F12128931663 snca-7 2 3 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction snca-8 1 3 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction