DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu The RNA helicase Aquarius exhibits structural adaptations mediating its recruitment to spliceosomes. The RNA helicase Aquarius exhibits structural adaptations mediating its recruitment to spliceosomes. Nature structural & molecular biology 2015 imex curation De I., Bessonov S., Hofele R., dos Santos K., Will CL., Urlaub H., Lührmann R., Pena V. Only protein-protein interactions in vitro In vitro ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom weight by comassie molecular weight estimation by coomasie staining weight by comassie De I., Bessonov S., Hofele R., dos Santos K., Will CL., Urlaub H., Lührmann R., Pena V. DIP original experiment: DIP-265648X Nature structural & molecular biology 2015 IMEx The RNA helicase Aquarius exhibits structural adaptations mediating its recruitment to spliceosomes. The RNA helicase Aquarius exhibits structural adaptations mediating its recruitment to spliceosomes. The RNA helicase Aquarius exhibits structural adaptations mediating its recruitment to spliceosomes. Nature structural & molecular biology 2015 imex curation De I., Bessonov S., Hofele R., dos Santos K., Will CL., Urlaub H., Lührmann R., Pena V. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined De I., Bessonov S., Hofele R., dos Santos K., Will CL., Urlaub H., Lührmann R., Pena V. DIP original experiment: DIP-265659X Nature structural & molecular biology 2015 IMEx The RNA helicase Aquarius exhibits structural adaptations mediating its recruitment to spliceosomes. The RNA helicase Aquarius exhibits structural adaptations mediating its recruitment to spliceosomes. The RNA helicase Aquarius exhibits structural adaptations mediating its recruitment to spliceosomes. Nature structural & molecular biology 2015 imex curation De I., Bessonov S., Hofele R., dos Santos K., Will CL., Urlaub H., Lührmann R., Pena V. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined De I., Bessonov S., Hofele R., dos Santos K., Will CL., Urlaub H., Lührmann R., Pena V. DIP original experiment: DIP-265655X Nature structural & molecular biology 2015 IMEx The RNA helicase Aquarius exhibits structural adaptations mediating its recruitment to spliceosomes. The RNA helicase Aquarius exhibits structural adaptations mediating its recruitment to spliceosomes. The RNA helicase Aquarius exhibits structural adaptations mediating its recruitment to spliceosomes. Nature structural & molecular biology 2015 imex curation De I., Bessonov S., Hofele R., dos Santos K., Will CL., Urlaub H., Lührmann R., Pena V. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined De I., Bessonov S., Hofele R., dos Santos K., Will CL., Urlaub H., Lührmann R., Pena V. DIP original experiment: DIP-265668X Nature structural & molecular biology 2015 IMEx The RNA helicase Aquarius exhibits structural adaptations mediating its recruitment to spliceosomes. The RNA helicase Aquarius exhibits structural adaptations mediating its recruitment to spliceosomes. The RNA helicase Aquarius exhibits structural adaptations mediating its recruitment to spliceosomes. Nature structural & molecular biology 2015 imex curation De I., Bessonov S., Hofele R., dos Santos K., Will CL., Urlaub H., Lührmann R., Pena V. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined De I., Bessonov S., Hofele R., dos Santos K., Will CL., Urlaub H., Lührmann R., Pena V. DIP original experiment: DIP-265667X Nature structural & molecular biology 2015 IMEx The RNA helicase Aquarius exhibits structural adaptations mediating its recruitment to spliceosomes. The RNA helicase Aquarius exhibits structural adaptations mediating its recruitment to spliceosomes. The RNA helicase Aquarius exhibits structural adaptations mediating its recruitment to spliceosomes. Nature structural & molecular biology 2015 imex curation De I., Bessonov S., Hofele R., dos Santos K., Will CL., Urlaub H., Lührmann R., Pena V. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined De I., Bessonov S., Hofele R., dos Santos K., Will CL., Urlaub H., Lührmann R., Pena V. DIP original experiment: DIP-265657X Nature structural & molecular biology 2015 IMEx The RNA helicase Aquarius exhibits structural adaptations mediating its recruitment to spliceosomes. The RNA helicase Aquarius exhibits structural adaptations mediating its recruitment to spliceosomes. The RNA helicase Aquarius exhibits structural adaptations mediating its recruitment to spliceosomes. Nature structural & molecular biology 2015 imex curation De I., Bessonov S., Hofele R., dos Santos K., Will CL., Urlaub H., Lührmann R., Pena V. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined De I., Bessonov S., Hofele R., dos Santos K., Will CL., Urlaub H., Lührmann R., Pena V. DIP original experiment: DIP-265654X Nature structural & molecular biology 2015 IMEx The RNA helicase Aquarius exhibits structural adaptations mediating its recruitment to spliceosomes. The RNA helicase Aquarius exhibits structural adaptations mediating its recruitment to spliceosomes. The RNA helicase Aquarius exhibits structural adaptations mediating its recruitment to spliceosomes. Nature structural & molecular biology 2015 imex curation De I., Bessonov S., Hofele R., dos Santos K., Will CL., Urlaub H., Lührmann R., Pena V. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined De I., Bessonov S., Hofele R., dos Santos K., Will CL., Urlaub H., Lührmann R., Pena V. DIP original experiment: DIP-265663X Nature structural & molecular biology 2015 IMEx The RNA helicase Aquarius exhibits structural adaptations mediating its recruitment to spliceosomes. The RNA helicase Aquarius exhibits structural adaptations mediating its recruitment to spliceosomes. The RNA helicase Aquarius exhibits structural adaptations mediating its recruitment to spliceosomes. Nature structural & molecular biology 2015 imex curation De I., Bessonov S., Hofele R., dos Santos K., Will CL., Urlaub H., Lührmann R., Pena V. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined De I., Bessonov S., Hofele R., dos Santos K., Will CL., Urlaub H., Lührmann R., Pena V. DIP original experiment: DIP-265652X Nature structural & molecular biology 2015 IMEx The RNA helicase Aquarius exhibits structural adaptations mediating its recruitment to spliceosomes. The RNA helicase Aquarius exhibits structural adaptations mediating its recruitment to spliceosomes. The RNA helicase Aquarius exhibits structural adaptations mediating its recruitment to spliceosomes. Nature structural & molecular biology 2015 imex curation De I., Bessonov S., Hofele R., dos Santos K., Will CL., Urlaub H., Lührmann R., Pena V. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined De I., Bessonov S., Hofele R., dos Santos K., Will CL., Urlaub H., Lührmann R., Pena V. DIP original experiment: DIP-265651X Nature structural & molecular biology 2015 IMEx The RNA helicase Aquarius exhibits structural adaptations mediating its recruitment to spliceosomes. The RNA helicase Aquarius exhibits structural adaptations mediating its recruitment to spliceosomes. The RNA helicase Aquarius exhibits structural adaptations mediating its recruitment to spliceosomes. Nature structural & molecular biology 2015 imex curation De I., Bessonov S., Hofele R., dos Santos K., Will CL., Urlaub H., Lührmann R., Pena V. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined De I., Bessonov S., Hofele R., dos Santos K., Will CL., Urlaub H., Lührmann R., Pena V. DIP original experiment: DIP-265669X Nature structural & molecular biology 2015 IMEx The RNA helicase Aquarius exhibits structural adaptations mediating its recruitment to spliceosomes. The RNA helicase Aquarius exhibits structural adaptations mediating its recruitment to spliceosomes. The RNA helicase Aquarius exhibits structural adaptations mediating its recruitment to spliceosomes. Nature structural & molecular biology 2015 imex curation De I., Bessonov S., Hofele R., dos Santos K., Will CL., Urlaub H., Lührmann R., Pena V. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined De I., Bessonov S., Hofele R., dos Santos K., Will CL., Urlaub H., Lührmann R., Pena V. DIP original experiment: DIP-265658X Nature structural & molecular biology 2015 IMEx The RNA helicase Aquarius exhibits structural adaptations mediating its recruitment to spliceosomes. The RNA helicase Aquarius exhibits structural adaptations mediating its recruitment to spliceosomes. The RNA helicase Aquarius exhibits structural adaptations mediating its recruitment to spliceosomes. Nature structural & molecular biology 2015 imex curation De I., Bessonov S., Hofele R., dos Santos K., Will CL., Urlaub H., Lührmann R., Pena V. Only protein-protein interactions in vitro In vitro light scattering light scattering predetermined predetermined participant predetermined De I., Bessonov S., Hofele R., dos Santos K., Will CL., Urlaub H., Lührmann R., Pena V. DIP original experiment: DIP-265650X Nature structural & molecular biology 2015 IMEx The RNA helicase Aquarius exhibits structural adaptations mediating its recruitment to spliceosomes. The RNA helicase Aquarius exhibits structural adaptations mediating its recruitment to spliceosomes. The RNA helicase Aquarius exhibits structural adaptations mediating its recruitment to spliceosomes. Nature structural & molecular biology 2015 imex curation De I., Bessonov S., Hofele R., dos Santos K., Will CL., Urlaub H., Lührmann R., Pena V. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie De I., Bessonov S., Hofele R., dos Santos K., Will CL., Urlaub H., Lührmann R., Pena V. DIP original experiment: DIP-265647X Nature structural & molecular biology 2015 IMEx The RNA helicase Aquarius exhibits structural adaptations mediating its recruitment to spliceosomes. The RNA helicase Aquarius exhibits structural adaptations mediating its recruitment to spliceosomes. The RNA helicase Aquarius exhibits structural adaptations mediating its recruitment to spliceosomes. Nature structural & molecular biology 2015 imex curation De I., Bessonov S., Hofele R., dos Santos K., Will CL., Urlaub H., Lührmann R., Pena V. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined De I., Bessonov S., Hofele R., dos Santos K., Will CL., Urlaub H., Lührmann R., Pena V. DIP original experiment: DIP-265656X Nature structural & molecular biology 2015 IMEx The RNA helicase Aquarius exhibits structural adaptations mediating its recruitment to spliceosomes. The RNA helicase Aquarius exhibits structural adaptations mediating its recruitment to spliceosomes. The RNA helicase Aquarius exhibits structural adaptations mediating its recruitment to spliceosomes. Nature structural & molecular biology 2015 imex curation De I., Bessonov S., Hofele R., dos Santos K., Will CL., Urlaub H., Lührmann R., Pena V. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie De I., Bessonov S., Hofele R., dos Santos K., Will CL., Urlaub H., Lührmann R., Pena V. DIP original experiment: DIP-265649X Nature structural & molecular biology 2015 IMEx The RNA helicase Aquarius exhibits structural adaptations mediating its recruitment to spliceosomes. The RNA helicase Aquarius exhibits structural adaptations mediating its recruitment to spliceosomes. The RNA helicase Aquarius exhibits structural adaptations mediating its recruitment to spliceosomes. Nature structural & molecular biology 2015 imex curation De I., Bessonov S., Hofele R., dos Santos K., Will CL., Urlaub H., Lührmann R., Pena V. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined De I., Bessonov S., Hofele R., dos Santos K., Will CL., Urlaub H., Lührmann R., Pena V. DIP original experiment: DIP-265664X Nature structural & molecular biology 2015 IMEx The RNA helicase Aquarius exhibits structural adaptations mediating its recruitment to spliceosomes. The RNA helicase Aquarius exhibits structural adaptations mediating its recruitment to spliceosomes. The RNA helicase Aquarius exhibits structural adaptations mediating its recruitment to spliceosomes. Nature structural & molecular biology 2015 imex curation De I., Bessonov S., Hofele R., dos Santos K., Will CL., Urlaub H., Lührmann R., Pena V. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined De I., Bessonov S., Hofele R., dos Santos K., Will CL., Urlaub H., Lührmann R., Pena V. DIP original experiment: DIP-265653X Nature structural & molecular biology 2015 IMEx The RNA helicase Aquarius exhibits structural adaptations mediating its recruitment to spliceosomes. The RNA helicase Aquarius exhibits structural adaptations mediating its recruitment to spliceosomes. The RNA helicase Aquarius exhibits structural adaptations mediating its recruitment to spliceosomes. Nature structural & molecular biology 2015 imex curation De I., Bessonov S., Hofele R., dos Santos K., Will CL., Urlaub H., Lührmann R., Pena V. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined De I., Bessonov S., Hofele R., dos Santos K., Will CL., Urlaub H., Lührmann R., Pena V. DIP original experiment: DIP-265660X Nature structural & molecular biology 2015 IMEx The RNA helicase Aquarius exhibits structural adaptations mediating its recruitment to spliceosomes. The RNA helicase Aquarius exhibits structural adaptations mediating its recruitment to spliceosomes. The RNA helicase Aquarius exhibits structural adaptations mediating its recruitment to spliceosomes. Nature structural & molecular biology 2015 imex curation De I., Bessonov S., Hofele R., dos Santos K., Will CL., Urlaub H., Lührmann R., Pena V. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined De I., Bessonov S., Hofele R., dos Santos K., Will CL., Urlaub H., Lührmann R., Pena V. DIP original experiment: DIP-265666X Nature structural & molecular biology 2015 IMEx The RNA helicase Aquarius exhibits structural adaptations mediating its recruitment to spliceosomes. The RNA helicase Aquarius exhibits structural adaptations mediating its recruitment to spliceosomes. The RNA helicase Aquarius exhibits structural adaptations mediating its recruitment to spliceosomes. Nature structural & molecular biology 2015 imex curation De I., Bessonov S., Hofele R., dos Santos K., Will CL., Urlaub H., Lührmann R., Pena V. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined De I., Bessonov S., Hofele R., dos Santos K., Will CL., Urlaub H., Lührmann R., Pena V. DIP original experiment: DIP-265661X Nature structural & molecular biology 2015 IMEx The RNA helicase Aquarius exhibits structural adaptations mediating its recruitment to spliceosomes. The RNA helicase Aquarius exhibits structural adaptations mediating its recruitment to spliceosomes. The RNA helicase Aquarius exhibits structural adaptations mediating its recruitment to spliceosomes. Nature structural & molecular biology 2015 imex curation De I., Bessonov S., Hofele R., dos Santos K., Will CL., Urlaub H., Lührmann R., Pena V. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined De I., Bessonov S., Hofele R., dos Santos K., Will CL., Urlaub H., Lührmann R., Pena V. DIP original experiment: DIP-265665X Nature structural & molecular biology 2015 IMEx The RNA helicase Aquarius exhibits structural adaptations mediating its recruitment to spliceosomes. The RNA helicase Aquarius exhibits structural adaptations mediating its recruitment to spliceosomes. The RNA helicase Aquarius exhibits structural adaptations mediating its recruitment to spliceosomes. Nature structural & molecular biology 2015 imex curation De I., Bessonov S., Hofele R., dos Santos K., Will CL., Urlaub H., Lührmann R., Pena V. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined De I., Bessonov S., Hofele R., dos Santos K., Will CL., Urlaub H., Lührmann R., Pena V. DIP original experiment: DIP-265662X Nature structural & molecular biology 2015 IMEx The RNA helicase Aquarius exhibits structural adaptations mediating its recruitment to spliceosomes. zn830_human Zinc finger protein 830 ZNF830 CCDC16 Coiled-coil domain-containing protein 16 protein protein human Homo sapiens Human MASSASARTPAGKRVINQEELRRLMKEKQRLSTSRKRIESPFAKYNRLGQLSCALCNTPVKSELLWQTHVLGKQHREKVAELKGAKEASQGSSASSAPHSVKRKAPDADDQDVKRAKATLVPQVQPSTSAWTTNFDKIGKEFIRATPSKPSGLSLLPDYEDEEEEEEEEEGDGERKRGDASKPLSDAQGKEHSVSSSREVTSSVLPNDFFSTNPPKAPIIPHSGSIEKAEIHEKVVERRENTAEALPEGFFDDPEVDARVRKVDAPKDQMDKEWDEFQKAMRQVNTISEAIVAEEDEEGRLDRQIGEIDEQIECYRRVEKLRNRQDEIKNKLKEILTIKELQKKEEENADSDDEGELQDLLSQDWRVKGALL DIP protein Q96NB3 original sequence version: 106 A06403B117672C8C o75533-1 Splicing factor 3B subunit 1 SF3B1 SAP155 Pre-mRNA-splicing factor SF3b 155 kDa subunit Spliceosome-associated protein 155 protein protein human Homo sapiens Human MAKIAKTHEDIEAQIREIQGKKAALDEAQGVGLDSTGYYDQEIYGGSDSRFAGYVTSIAATELEDDDDDYSSSTSLLGQKKPGYHAPVALLNDIPQSTEQYDPFAEHRPPKIADREDEYKKHRRTMIISPERLDPFADGGKTPDPKMNARTYMDVMREQHLTKEEREIRQQLAEKAKAGELKVVNGAAASQPPSKRKRRWDQTADQTPGATPKKLSSWDQAETPGHTPSLRWDETPGRAKGSETPGATPGSKIWDPTPSHTPAGAATPGRGDTPGHATPGHGGATSSARKNRWDETPKTERDTPGHGSGWAETPRTDRGGDSIGETPTPGASKRKSRWDETPASQMGGSTPVLTPGKTPIGTPAMNMATPTPGHIMSMTPEQLQAWRWEREIDERNRPLSDEELDAMFPEGYKVLPPPAGYVPIRTPARKLTATPTPLGGMTGFHMQTEDRTMKSVNDQPSGNLPFLKPDDIQYFDKLLVDVDESTLSPEEQKERKIMKLLLKIKNGTPPMRKAALRQITDKAREFGAGPLFNQILPLLMSPTLEDQERHLLVKVIDRILYKLDDLVRPYVHKILVVIEPLLIDEDYYARVEGREIISNLAKAAGLATMISTMRPDIDNMDEYVRNTTARAFAVVASALGIPSLLPFLKAVCKSKKSWQARHTGIKIVQQIAILMGCAILPHLRSLVEIIEHGLVDEQQKVRTISALAIAALAEAATPYGIESFDSVLKPLWKGIRQHRGKGLAAFLKAIGYLIPLMDAEYANYYTREVMLILIREFQSPDEEMKKIVLKVVKQCCGTDGVEANYIKTEILPPFFKHFWQHRMALDRRNYRQLVDTTVELANKVGAAEIISRIVDDLKDEAEQYRKMVMETIEKIMGNLGAADIDHKLEEQLIDGILYAFQEQTTEDSVMLNGFGTVVNALGKRVKPYLPQICGTVLWRLNNKSAKVRQQAADLISRTAVVMKTCQEEKLMGHLGVVLYEYLGEEYPEVLGSILGALKAIVNVIGMHKMTPPIKDLLPRLTPILKNRHEKVQENCIDLVGRIADRGAEYVSAREWMRICFELLELLKAHKKAIRRATVNTFGYIAKAIGPHDVLATLLNNLKVQERQNRVCTTVAIAIVAETCSPFTVLPALMNEYRVPELNVQNGVLKSLSFLFEYIGEMGKDYIYAVTPLLEDALMDRDLVHRQTASAVVQHMSLGVYGFGCEDSLNHLLNYVWPNVFETSPHVIQAVMGALEGLRVAIGPCRMLQYCLQGLFHPARKVRDVYWKIYNSIYIGSQDALIAHYPRIYNDDKNTYIRYELDYIL DIP protein O75533-1 original sequence version: 141 DIP protein O75533 original sequence version: 65 DIP protein O75533 original sequence version: 145 DIP protein O75533 original sequence version: 120 ru2a_human U2 small nuclear ribonucleoprotein A' SNRPA1 protein protein human Homo sapiens Human MVKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLKTLLVNNNRICRIGEGLDQALPCLTELILTNNSLVELGDLDPLASLKSLTYLSILRNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAEKMFKGKRGAQLAKDIARRSKTFNPGAGLPTDKKKGGPSPGDVEAIKNAIANASTLAEVERLKGLLQSGQIPGRERRSGPTDDGEEEMEEDTVTNGS DIP protein P09661 original sequence version: 153 25902F07992B7209 sf3b3_human Splicing factor 3B subunit 3 SF3B3 KIAA0017 SAP130 Spliceosome-associated protein 130 Pre-mRNA-splicing factor SF3b 130 kDa subunit STAF130 protein protein human Homo sapiens Human MFLYNLTLQRATGISFAIHGNFSGTKQQEIVVSRGKILELLRPDPNTGKVHTLLTVEVFGVIRSLMAFRLTGGTKDYIVVGSDSGRIVILEYQPSKNMFEKIHQETFGKSGCRRIVPGQFLAVDPKGRAVMISAIEKQKLVYILNRDAAARLTISSPLEAHKANTLVYHVVGVDVGFENPMFACLEMDYEEADNDPTGEAAANTQQTLTFYELDLGLNHVVRKYSEPLEEHGNFLITVPGGSDGPSGVLICSENYITYKNFGDQPDIRCPIPRRRNDLDDPERGMIFVCSATHKTKSMFFFLAQTEQGDIFKITLETDEDMVTEIRLKYFDTVPVAAAMCVLKTGFLFVASEFGNHYLYQIAHLGDDDEEPEFSSAMPLEEGDTFFFQPRPLKNLVLVDELDSLSPILFCQIADLANEDTPQLYVACGRGPRSSLRVLRHGLEVSEMAVSELPGNPNAVWTVRRHIEDEFDAYIIVSFVNATLVLSIGETVEEVTDSGFLGTTPTLSCSLLGDDALVQVYPDGIRHIRADKRVNEWKTPGKKTIVKCAVNQRQVVIALTGGELVYFEMDPSGQLNEYTERKEMSADVVCMSLANVPPGEQRSRFLAVGLVDNTVRIISLDPSDCLQPLSMQALPAQPESLCIVEMGGTEKQDELGERGSIGFLYLNIGLQNGVLLRTVLDPVTGDLSDTRTRYLGSRPVKLFRVRMQGQEAVLAMSSRSWLSYSYQSRFHLTPLSYETLEFASGFASEQCPEGIVAISTNTLRILALEKLGAVFNQVAFPLQYTPRKFVIHPESNNLIIIETDHNAYTEATKAQRKQQMAEEMVEAAGEDERELAAEMAAAFLNENLPESIFGAPKAGNGQWASVIRVMNPIQGNTLDLVQLEQNEAAFSVAVCRFSNTGEDWYVLVGVAKDLILNPRSVAGGFVYTYKLVNNGEKLEFLHKTPVEEVPAAIAPFQGRVLIGVGKLLRVYDLGKKKLLRKCENKHIANYISGIQTIGHRVIVSDVQESFIWVRYKRNENQLIIFADDTYPRWVTTASLLDYDTVAGADKFGNICVVRLPPNTNDEVDEDPTGNKALWDRGLLNGASQKAEVIMNYHVGETVLSLQKTTLIPGGSESLVYTTLSGGIGILVPFTSHEDHDFFQHVEMHLRSEHPPLCGRDHLSFRSYYFPVKNVIDGDLCEQFNSMEPNKQKNVSEELDRTPPEVSKKLEDIRTRYAF DIP protein Q15393 original sequence version: 144 35CACAF5ACC32512 sf3a2_human Splicing factor 3A subunit 2 SF3A2 SAP62 Spliceosome-associated protein 62 SF3a66 protein protein human Homo sapiens Human MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCLTLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAPAQPAPEKVKVEVKKFVKIGRPGYKVTKQRDSEMGQQSLLFQIDYPEIAEGIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYETIAFKVPSREIDKAEGKFWTHWNRETKQFFLQFHFKMEKPPAPPSLPAGPPGVKRPPPPLMNGLPPRPPLPESLPPPPPGGLPLPPMPPTGPAPSGPPGPPQLPPPAPGVHPPAPVVHPPASGVHPPAPGVHPPAPGVHPPAPGVHPPTSGVHPPAPGVHPPAPGVHPPAPGVHPPAPGVHPPAPGVHPPPSAGVHPQAPGVHPAAPAVHPQAPGVHPPAPGMHPQAPGVHPQPPGVHPSAPGVHPQPPGVHPSNPGVHPPTPMPPMLRPPLPSEGPGNIPPPPPTN DIP protein Q15428 original sequence version: 135 FA46F064A55EA2CE aqr_human RNA helicase aquarius AQR KIAA0560 Intron-binding protein of 160 kDa protein protein human Homo sapiens Human MAAPAQPKKIVAPTVSQINAEFVTQLACKYWAPHIKKKSPFDIKVIEDIYEKEIVKSRFAIRKIMLLEFSQYLENYLWMNYSPEVSSKAYLMSICCMVNEKFRENVPAWEIFKKKPDHFPFFFKHILKAALAETDGEFSLHEQTVLLLFLDHCFNSLEVDLIRSQVQQLISLPMWMGLQLARLELELKKTPKLRKFWNLIKKNDEKMDPEAREQAYQERRFLSQLIQKFISVLKSVPLSEPVTMDKVHYCERFIELMIDLEALLPTRRWFNTILDDSHLLVHCYLSNLVRREEDGHLFSQLLDMLKFYTGFEINDQTGNALTENEMTTIHYDRITSLQRAAFAHFPELYDFALSNVAEVDTRESLVKFFGPLSSNTLHQVASYLCLLPTLPKNEDTTFDKEFLLELLVSRHERRISQIQQLNQMPLYPTEKIIWDENIVPTEYYSGEGCLALPKLNLQFLTLHDYLLRNFNLFRLESTYEIRQDIEDSVSRMKPWQSEYGGVVFGGWARMAQPIVAFTVVEVAKPNIGENWPTRVRADVTINLNVRDHIKDEWEGLRKHDVCFLITVRPTKPYGTKFDRRRPFIEQVGLVYVRGCEIQGMLDDKGRVIEDGPEPRPNLRGESRTFRVFLDPNQYQQDMTNTIQNGAEDVYETFNIIMRRKPKENNFKAVLETIRNLMNTDCVVPDWLHDIILGYGDPSSAHYSKMPNQIATLDFNDTFLSIEHLKASFPGHNVKVTVEDPALQIPPFRITFPVRSGKGKKRKDADVEDEDTEEAKTLIVEPHVIPNRGPYPYNQPKRNTIQFTHTQIEAIRAGMQPGLTMVVGPPGTGKTDVAVQIISNIYHNFPEQRTLIVTHSNQALNQLFEKIMALDIDERHLLRLGHGEEELETEKDFSRYGRVNYVLARRIELLEEVKRLQKSLGVPGDASYTCETAGYFFLYQVMSRWEEYISKVKNKGSTLPDVTEVSTFFPFHEYFANAPQPIFKGRSYEEDMEIAEGCFRHIKKIFTQLEEFRASELLRSGLDRSKYLLVKEAKIIAMTCTHAALKRHDLVKLGFKYDNILMEEAAQILEIETFIPLLLQNPQDGFSRLKRWIMIGDHHQLPPVIKNMAFQKYSNMEQSLFTRFVRVGVPTVDLDAQGRARASLCNLYNWRYKNLGNLPHVQLLPEFSTANAGLLYDFQLINVEDFQGVGESEPNPYFYQNLGEAEYVVALFMYMCLLGYPADKISILTTYNGQKHLIRDIINRRCGNNPLIGRPNKVTTVDRFQGQQNDYILLSLVRTRAVGHLRDVRRLVVAMSRARLGLYIFARVSLFQNCFELTPAFSQLTARPLHLHIIPTEPFPTTRKNGERPSHEVQIIKNMPQMANFVYNMYMHLIQTTHHYHQTLLQLPPAMVEEGEEVQNQETELETEEEAMTVQADIIPSPTDTSCRQETPAFQTDTTPSETGATSTPEAIPALSETTPTVVGAVSAPAEANTPQDATSAPEETK DIP protein O60306 original sequence version: 104 D0ADDA621A9418FD isy1_human Pre-mRNA-splicing factor ISY1 homolog ISY1 KIAA1160 protein protein human Homo sapiens Human MARNAEKAMTALARFRQAQLEEGKVKERRPFLASECTELPKAEKWRRQIIGEISKKVAQIQNAGLGEFRIRDLNDEINKLLREKGHWEVRIKELGGPDYGKVGPKMLDHEGKEVPGNRGYKYFGAAKDLPGVRELFEKEPLPPPRKTRAELMKAIDFEYYGYLDEDDGVIVPLEQEYEKKLRAELVEKWKAEREARLARGEKEEEEEEEEEINIYAVTEEESDEEGSQEKGGDDSQQKFIAHVPVPSQQEIEEALVRRKKMELLQKYASETLQAQSEEARRLLGY DIP protein Q9ULR0 original sequence version: 99 AB43602EBCB51B2C syf1_human Pre-mRNA-splicing factor SYF1 XAB2 HCNP KIAA1177 PP3898 SYF1 XPA-binding protein 2 Protein HCNP protein protein human Homo sapiens Human MVVMARLSRPERPDLVFEEEDLPYEEEIMRNQFSVKCWLRYIEFKQGAPKPRLNQLYERALKLLPCSYKLWYRYLKARRAQVKHRCVTDPAYEDVNNCHERAFVFMHKMPRLWLDYCQFLMDQGRVTHTRRTFDRALRALPITQHSRIWPLYLRFLRSHPLPETAVRGYRRFLKLSPESAEEYIEYLKSSDRLDEAAQRLATVVNDERFVSKAGKSNYQLWHELCDLISQNPDKVQSLNVDAIIRGGLTRFTDQLGKLWCSLADYYIRSGHFEKARDVYEEAIRTVMTVRDFTQVFDSYAQFEESMIAAKMETASELGREEEDDVDLELRLARFEQLISRRPLLLNSVLLRQNPHHVHEWHKRVALHQGRPREIINTYTEAVQTVDPFKATGKPHTLWVAFAKFYEDNGQLDDARVILEKATKVNFKQVDDLASVWCQCGELELRHENYDEALRLLRKATALPARRAEYFDGSEPVQNRVYKSLKVWSMLADLEESLGTFQSTKAVYDRILDLRIATPQIVINYAMFLEEHKYFEESFKAYERGISLFKWPNVSDIWSTYLTKFIARYGGRKLERARDLFEQALDGCPPKYAKTLYLLYAQLEEEWGLARHAMAVYERATRAVEPAQQYDMFNIYIKRAAEIYGVTHTRGIYQKAIEVLSDEHAREMCLRFADMECKLGEIDRARAIYSFCSQICDPRTTGAFWQTWKDFEVRHGNEDTIKEMLRIRRSVQATYNTQVNFMASQMLKVSGSATGTVSDLAPGQSGMDDMKLLEQRAEQLAAEAERDQPLRAQSKILFVRSDASREELAELAQQVNPEEIQLGEDEDEDEMDLEPNEVRLEQQSVPAAVFGSLKED DIP protein Q9HCS7 original sequence version: 139 CF766917CD65F6FD sf3a1_human Splicing factor 3A subunit 1 Spliceosome-associated protein 114 SF3a120 SF3A1 SAP114 protein protein human Homo sapiens Human MPAGPVQAVPPPPPVPTEPKQPTEEEASSKEDSAPSKPVVGIIYPPPEVRNIVDKTASFVARNGPEFEARIRQNEINNPKFNFLNPNDPYHAYYRHKVSEFKEGKAQEPSAAIPKVMQQQQQTTQQQLPQKVQAQVIQETIVPKEPPPEFEFIADPPSISAFDLDVVKLTAQFVARNGRQFLTQLMQKEQRNYQFDFLRPQHSLFNYFTKLVEQYTKILIPPKGLFSKLKKEAENPREVLDQVCYRVEWAKFQERERKKEEEEKEKERVAYAQIDWHDFVVVETVDFQPNEQGNFPPPTTPEELGARILIQERYEKFGESEEVEMEVESDEEDDKQEKAEEPPSQLDQDTQVQDMDEGSDDEEEGQKVPPPPETPMPPPLPPTPDQVIVRKDYDPKASKPLPPAPAPDEYLVSPITGEKIPASKMQEHMRIGLLDPRWLEQRDRSIREKQSDDEVYAPGLDIESSLKQLAERRTDIFGVEETAIGKKIGEEEIQKPEEKVTWDGHSGSMARTQQAAQANITLQEQIEAIHKAKGLVPEDDTKEKIGPSKPNEIPQQPPPPSSATNIPSSAPPITSVPRPPTMPPPVRTTVVSAVPVMPRPPMASVVRLPPGSVIAPMPPIIHAPRINVVPMPPSAPPIMAPRPPPMIVPTAFVPAPPVAPVPAPAPMPPVHPPPPMEDEPTSKKLKTEDSLMPEEEFLRRNKGPVSIKVQVPNMQDKTEWKLNGQVLVFTLPLTDQVSVIKVKIHEATGMPAGKQKLQYEGIFIKDSNSLAYYNMANGAVIHLALKERGGRKK DIP protein Q15459 original sequence version: 66 DIP protein Q15459 original sequence version: 158 7259F1EC4577305C ppie_human Peptidyl-prolyl cis-trans isomerase E Cyclophilin E Cyclophilin-33 PPIE CYP33 Rotamase E protein protein human Homo sapiens Human MATTKRVLYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDAAAAIDNMNESELFGRTIRVNLAKPMRIKEGSSRPVWSDDDWLKKFSGKTLEENKEEEGSEPPKAETQEGEPIAKKARSNPQVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHEKGFGFKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEAQGSKDGKPKQKVIIADCGEYV DIP protein Q9UNP9 original sequence version: 150 F3226149A790BA42 aqr-znf830-1 18 24 unspecified role unspecified role unspecified role unspecified role K83 K83 xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper 29 unspecified role unspecified role unspecified role unspecified role K1045 K1045 xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction aqr-isy1-1 14 33 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper 30 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper 24 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper 31 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper 29 unspecified role unspecified role unspecified role unspecified role Region 1-416 Region 1-416 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper physical association physical association aqr-isy1-2 6 30 unspecified role unspecified role unspecified role unspecified role K266 K266 xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper 29 unspecified role unspecified role unspecified role unspecified role K37 K37 xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction aqr-ppie-1 23 33 unspecified role unspecified role unspecified role unspecified role K88 K88 xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper 29 unspecified role unspecified role unspecified role unspecified role K1234 K1234 xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction sf3b3-znf830-1 20 27 unspecified role unspecified role unspecified role unspecified role K980 K980 xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 24 unspecified role unspecified role unspecified role unspecified role K343 K343 xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human direct interaction direct interaction aqr-znf830-2 7 24 unspecified role unspecified role unspecified role unspecified role K117 K117 xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper 29 unspecified role unspecified role unspecified role unspecified role K604 K604 xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction snrpa1-xab2-1 11 31 unspecified role unspecified role unspecified role unspecified role V2 V2 xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 26 unspecified role unspecified role unspecified role unspecified role K205 K205 xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human direct interaction direct interaction aqr-xab2-1 12 31 unspecified role unspecified role unspecified role unspecified role K62 K62 xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper 29 unspecified role unspecified role unspecified role unspecified role K950 K950 xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction aqr-isy1-3 13 33 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper 30 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper 24 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper 31 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper 29 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper physical association physical association aqr-ppie-2 21 33 unspecified role unspecified role unspecified role unspecified role K123 K123 xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper 29 unspecified role unspecified role unspecified role unspecified role K604 K604 xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction aqr-isy1-4 1 33 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper 30 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper 24 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper 31 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper 29 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper physical association physical association ppie-sf3a2-1 22 28 unspecified role unspecified role unspecified role unspecified role K88 K88 xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 33 unspecified role unspecified role unspecified role unspecified role K83 K83 xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human direct interaction direct interaction aqr-znf830-3 3 24 unspecified role unspecified role unspecified role unspecified role K320 K320 xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper 29 unspecified role unspecified role unspecified role unspecified role K762 K762 xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction aqr-ppie-3 2 33 unspecified role unspecified role unspecified role unspecified role K88 K88 xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper 29 unspecified role unspecified role unspecified role unspecified role K1104 K1104 xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction ppie-sf3a1-1 17 32 unspecified role unspecified role unspecified role unspecified role P2 P2 xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 33 unspecified role unspecified role unspecified role unspecified role K218 K218 xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human direct interaction direct interaction isy1-snrpa1-1 4 26 unspecified role unspecified role unspecified role unspecified role K193 K193 xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 30 unspecified role unspecified role unspecified role unspecified role K264 K264 xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human direct interaction direct interaction aqr-znf830-4 10 24 unspecified role unspecified role unspecified role unspecified role K140 K140 xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper 29 unspecified role unspecified role unspecified role unspecified role K1256 K1256 xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction aqr-isy1-5 15 30 unspecified role unspecified role unspecified role unspecified role K101 K101 xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper 29 unspecified role unspecified role unspecified role unspecified role K604 K604 xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction aqr-isy1-6 16 33 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper 30 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper 24 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper 31 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper 29 unspecified role unspecified role bait bait Region 1-416 Region 1-416 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range trini Trichoplusia ni (Cabbage looper) Cabbage looper association association aqr-ppie-4 19 33 unspecified role unspecified role unspecified role unspecified role K114 K114 xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper 29 unspecified role unspecified role unspecified role unspecified role K1025 K1025 xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction aqr-sf3b1-1 8 25 unspecified role unspecified role unspecified role unspecified role K493 K493 xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 29 unspecified role unspecified role unspecified role unspecified role K188 K188 xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human direct interaction direct interaction isy1-sf3b3-1 5 30 unspecified role unspecified role unspecified role unspecified role K112 K112 xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 27 unspecified role unspecified role unspecified role unspecified role K296 K296 xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human direct interaction direct interaction aqr-znf830-5 9 24 unspecified role unspecified role unspecified role unspecified role K339 K339 xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper 29 unspecified role unspecified role unspecified role unspecified role K201 K201 xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction