DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structural biology. Division of labor in transhydrogenase by alternating proton translocation and hydride transfer. Structural biology. Division of labor in transhydrogenase by alternating proton translocation and hydride transfer. Science (New York, N.Y.) 2015 imex curation Leung JH., Schurig-Briccio LA., Yamaguchi M., Moeller A., Speir JA., Gennis RB., Stout CD. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Leung JH., Schurig-Briccio LA., Yamaguchi M., Moeller A., Speir JA., Gennis RB., Stout CD. DIP original experiment: DIP-265328X Science (New York, N.Y.) 2015 IMEx Structural biology. Division of labor in transhydrogenase by alternating proton translocation and hydride transfer. Structural biology. Division of labor in transhydrogenase by alternating proton translocation and hydride transfer. Structural biology. Division of labor in transhydrogenase by alternating proton translocation and hydride transfer. Science (New York, N.Y.) 2015 imex curation Leung JH., Schurig-Briccio LA., Yamaguchi M., Moeller A., Speir JA., Gennis RB., Stout CD. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Leung JH., Schurig-Briccio LA., Yamaguchi M., Moeller A., Speir JA., Gennis RB., Stout CD. DIP original experiment: DIP-265323X Science (New York, N.Y.) 2015 IMEx Structural biology. Division of labor in transhydrogenase by alternating proton translocation and hydride transfer. Structural biology. Division of labor in transhydrogenase by alternating proton translocation and hydride transfer. Structural biology. Division of labor in transhydrogenase by alternating proton translocation and hydride transfer. Science (New York, N.Y.) 2015 imex curation Leung JH., Schurig-Briccio LA., Yamaguchi M., Moeller A., Speir JA., Gennis RB., Stout CD. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Leung JH., Schurig-Briccio LA., Yamaguchi M., Moeller A., Speir JA., Gennis RB., Stout CD. DIP original experiment: DIP-265326X Science (New York, N.Y.) 2015 IMEx Structural biology. Division of labor in transhydrogenase by alternating proton translocation and hydride transfer. Structural biology. Division of labor in transhydrogenase by alternating proton translocation and hydride transfer. Structural biology. Division of labor in transhydrogenase by alternating proton translocation and hydride transfer. Science (New York, N.Y.) 2015 imex curation Leung JH., Schurig-Briccio LA., Yamaguchi M., Moeller A., Speir JA., Gennis RB., Stout CD. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Leung JH., Schurig-Briccio LA., Yamaguchi M., Moeller A., Speir JA., Gennis RB., Stout CD. DIP original experiment: DIP-265330X Science (New York, N.Y.) 2015 IMEx Structural biology. Division of labor in transhydrogenase by alternating proton translocation and hydride transfer. Structural biology. Division of labor in transhydrogenase by alternating proton translocation and hydride transfer. Structural biology. Division of labor in transhydrogenase by alternating proton translocation and hydride transfer. Science (New York, N.Y.) 2015 imex curation Leung JH., Schurig-Briccio LA., Yamaguchi M., Moeller A., Speir JA., Gennis RB., Stout CD. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Leung JH., Schurig-Briccio LA., Yamaguchi M., Moeller A., Speir JA., Gennis RB., Stout CD. DIP original experiment: DIP-265333X Science (New York, N.Y.) 2015 IMEx Structural biology. Division of labor in transhydrogenase by alternating proton translocation and hydride transfer. Structural biology. Division of labor in transhydrogenase by alternating proton translocation and hydride transfer. Structural biology. Division of labor in transhydrogenase by alternating proton translocation and hydride transfer. Science (New York, N.Y.) 2015 imex curation Leung JH., Schurig-Briccio LA., Yamaguchi M., Moeller A., Speir JA., Gennis RB., Stout CD. Only protein-protein interactions ecolx Escherichia coli 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Leung JH., Schurig-Briccio LA., Yamaguchi M., Moeller A., Speir JA., Gennis RB., Stout CD. DIP original experiment: DIP-265327X Science (New York, N.Y.) 2015 IMEx Structural biology. Division of labor in transhydrogenase by alternating proton translocation and hydride transfer. Structural biology. Division of labor in transhydrogenase by alternating proton translocation and hydride transfer. Structural biology. Division of labor in transhydrogenase by alternating proton translocation and hydride transfer. Science (New York, N.Y.) 2015 imex curation Leung JH., Schurig-Briccio LA., Yamaguchi M., Moeller A., Speir JA., Gennis RB., Stout CD. Only protein-protein interactions ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Leung JH., Schurig-Briccio LA., Yamaguchi M., Moeller A., Speir JA., Gennis RB., Stout CD. DIP original experiment: DIP-265331X Science (New York, N.Y.) 2015 IMEx Structural biology. Division of labor in transhydrogenase by alternating proton translocation and hydride transfer. Structural biology. Division of labor in transhydrogenase by alternating proton translocation and hydride transfer. Structural biology. Division of labor in transhydrogenase by alternating proton translocation and hydride transfer. Science (New York, N.Y.) 2015 imex curation Leung JH., Schurig-Briccio LA., Yamaguchi M., Moeller A., Speir JA., Gennis RB., Stout CD. Only protein-protein interactions ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Leung JH., Schurig-Briccio LA., Yamaguchi M., Moeller A., Speir JA., Gennis RB., Stout CD. DIP original experiment: DIP-265329X Science (New York, N.Y.) 2015 IMEx Structural biology. Division of labor in transhydrogenase by alternating proton translocation and hydride transfer. Structural biology. Division of labor in transhydrogenase by alternating proton translocation and hydride transfer. Structural biology. Division of labor in transhydrogenase by alternating proton translocation and hydride transfer. Science (New York, N.Y.) 2015 imex curation Leung JH., Schurig-Briccio LA., Yamaguchi M., Moeller A., Speir JA., Gennis RB., Stout CD. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Leung JH., Schurig-Briccio LA., Yamaguchi M., Moeller A., Speir JA., Gennis RB., Stout CD. DIP original experiment: DIP-265325X Science (New York, N.Y.) 2015 IMEx Structural biology. Division of labor in transhydrogenase by alternating proton translocation and hydride transfer. Structural biology. Division of labor in transhydrogenase by alternating proton translocation and hydride transfer. Structural biology. Division of labor in transhydrogenase by alternating proton translocation and hydride transfer. Science (New York, N.Y.) 2015 imex curation Leung JH., Schurig-Briccio LA., Yamaguchi M., Moeller A., Speir JA., Gennis RB., Stout CD. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Leung JH., Schurig-Briccio LA., Yamaguchi M., Moeller A., Speir JA., Gennis RB., Stout CD. DIP original experiment: DIP-265324X Science (New York, N.Y.) 2015 IMEx Structural biology. Division of labor in transhydrogenase by alternating proton translocation and hydride transfer. Structural biology. Division of labor in transhydrogenase by alternating proton translocation and hydride transfer. Structural biology. Division of labor in transhydrogenase by alternating proton translocation and hydride transfer. Science (New York, N.Y.) 2015 imex curation Leung JH., Schurig-Briccio LA., Yamaguchi M., Moeller A., Speir JA., Gennis RB., Stout CD. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Leung JH., Schurig-Briccio LA., Yamaguchi M., Moeller A., Speir JA., Gennis RB., Stout CD. DIP original experiment: DIP-265332X Science (New York, N.Y.) 2015 IMEx Structural biology. Division of labor in transhydrogenase by alternating proton translocation and hydride transfer. q72gr8_thet2 TT_C1780 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MVTVAVPKERAPGERRVALVPEVVARLVKGGARVRVERGAGEGAYHPDEAYQEAGAEVVERGELLKGAHLLFTVQPPPEDLIQALEPGAIVVGFVQPHKNLELVRALQAKKATVIAMELIPRITRAQSMDALSSQATVAGYLAAIHAARLSPRFFPMLTTAAGTIRPAKVMVMGVGVAGLMAIATAKRLGAQVFAYDVRKAALEQALSLGAKPIELPISAEGEGGYARELTEEEKRIQHEALRDHVAGMDVLITTAQVPGRRAPILLTEDMVERLKPGTVVVDLAAESGGNCVLTKPGEVVEVRGVRVYGPLNLPSELSVHASEMYAKNLYNLSSLLIEKGAFAPKWEDEIVRAALLMKEGEVLHGPTKALLGGA DIP protein Q72GR8 original sequence version: 66 q72gr9_thet2 Proton-translocating NAD(P)(+) transhydrogenase TT_C1779 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MEFGFWSALYIFVLTAFLGYELITRVPVILHTPLMSGSNFIHGVVVVGAMVVLGHAETGLEKLIGFLGVILGAANAAGGYAVTVRMLEMFERKPGQGGGR DIP protein Q72GR9 original sequence version: 50 q72gs0_thet2 NAD(P) transhydrogenase subunit beta Nicotinamide nucleotide transhydrogenase subunit beta TT_C1778 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MDLIQAAYFVVAILFIVGLKRMAHPTTAKSGIVWAGWGMVLAVLATFFWPGMGNFALILLALLLGSVVAWWAAVRVAMTDMPQMVAIYNGMGGGAAATIAAVELLKGAFENTGLMALAILGGLIGSVAFTGSLIAFAKLQGIMKSRPILFPGQKAVNALVLALTVVIGLSLLWNDATASIVLFFLLALLFGVLMTLPIGGGDMPVAISFYNAFTGMAVGFEGFAVGNPALMVAGTLVGAAGTLLTVLMARAMNRSVWSVLVGGFGVEQEAGEVKGSLKPIDVEDAAVMLAYAGKVVFVPGYGMALSQAQHKLKELADLLEARGVEVKFAIHPVAGRMPGHMNVLLAEAGVDYDKLKDLEEINPEFPTVDVAVVIGANDVVNPAARRPGSPLYGMPILDVDKAKNVIVIKRGQGKGFAGVENELFYAENTRMLYGDAQKVLTELIQALKRL DIP protein Q72GS0 original sequence version: 75 q72gr8_thet2-1 2 12 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction q72gr8_thet2-q72gr9_thet2-1 1 12 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 13 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 14 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association q72gr8_thet2-q72gr9_thet2-2 3 12 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 13 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 14 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association q72gr8_thet2-q72gs0_thet2-1 10 14 unspecified role unspecified role unspecified role unspecified role Region 266-450 Region 266-450 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 12 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction q72gr9_thet2-q72gs0_thet2-1 4 13 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 14 unspecified role unspecified role unspecified role unspecified role Region 1-263 Region 1-263 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction q72gr9_thet2-q72gs0_thet2-2 11 13 unspecified role unspecified role unspecified role unspecified role Q72GR9:p.Val28Cys V28C mutation mutation certain certain sequence position certain certain certain sequence position certain V C This feature has been corrected as a result of our quality control procedures. The original label was 'V28C'. Wed May 02 16:51:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val28cys' Tue Jun 30 19:03:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val28Cys' ecolx Escherichia coli 14 unspecified role unspecified role unspecified role unspecified role Q72GS0:p.Asp284Cys D284C mutation mutation certain certain sequence position certain certain certain sequence position certain D C This feature has been corrected as a result of our quality control procedures. The original label was 'D284C'. Wed May 02 15:37:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp284cys' Tue Jun 30 19:39:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp284Cys' ecolx Escherichia coli direct interaction direct interaction q72gs0_thet2-q72gr9_thet2-1 7 13 unspecified role unspecified role prey prey ecolx Escherichia coli 14 unspecified role unspecified role bait bait Region 1-263 Region 1-263 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli physical association physical association q72gr8_thet2-q72gr9_thet2-3 8 12 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 13 unspecified role unspecified role prey prey ecolx Escherichia coli 14 unspecified role unspecified role prey prey ecolx Escherichia coli association association q72gr8_thet2-q72gr9_thet2-4 6 12 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 13 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 14 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association q72gr9_thet2-q72gs0_thet2-3 9 13 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 14 unspecified role unspecified role unspecified role unspecified role Region 1-263 Region 1-263 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction q72gr8_thet2-q72gs0_thet2-2 5 12 unspecified role unspecified role unspecified role unspecified role Q72GR8:p.Thr164Cys T164C mutation mutation certain certain sequence position certain certain certain sequence position certain T C This feature has been corrected as a result of our quality control procedures. The original label was 'T164C'. Wed May 02 16:33:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr164cys' Tue Jun 30 17:54:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr164Cys' ecolx Escherichia coli 14 unspecified role unspecified role unspecified role unspecified role Q72GS0:p.Asp284Cys D284C mutation mutation certain certain sequence position certain certain certain sequence position certain D C This feature has been corrected as a result of our quality control procedures. The original label was 'D284C'. Wed May 02 17:52:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp284cys' Tue Jun 30 18:54:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp284Cys' ecolx Escherichia coli direct interaction direct interaction