DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Modeling an in-register, parallel "iowa" aβ fibril structure using solid-state NMR data from labeled samples with rosetta. Modeling an in-register, parallel "iowa" aβ fibril structure using solid-state NMR data from labeled samples with rosetta. Structure (London, England : 1993) 2015 imex curation Sgourakis NG., Yau WM., Qiang W., Sgourakis NG., Yau WM., Qiang W. Alzheimers - Interactions investigated in the context of Alzheimers disease Only protein-protein interactions in vitro In vitro solid state nmr solid state nmr ssnmr solid state nmr predetermined predetermined participant predetermined Sgourakis NG., Yau WM., Qiang W. Alzheimers - Interactions investigated in the context of Alzheimers disease DIP original experiment: DIP-264726X Structure (London, England : 1993) 2015 IMEx Modeling an in-register, parallel "iowa" aβ fibril structure using solid-state NMR data from labeled samples with rosetta. Modeling an in-register, parallel "iowa" aβ fibril structure using solid-state NMR data from labeled samples with rosetta. Modeling an in-register, parallel "iowa" aβ fibril structure using solid-state NMR data from labeled samples with rosetta. Structure (London, England : 1993) 2015 imex curation Sgourakis NG., Yau WM., Qiang W., Sgourakis NG., Yau WM., Qiang W. Alzheimers - Interactions investigated in the context of Alzheimers disease Only protein-protein interactions in vitro In vitro tem transmission electron microscopy tem predetermined predetermined participant predetermined Sgourakis NG., Yau WM., Qiang W. Alzheimers - Interactions investigated in the context of Alzheimers disease DIP original experiment: DIP-264725X Structure (London, England : 1993) 2015 IMEx Modeling an in-register, parallel "iowa" aβ fibril structure using solid-state NMR data from labeled samples with rosetta. p05067-pro_0000000093 Amyloid-beta protein 40 APP A4 AD1 ABPP Alzheimer disease amyloid protein Cerebral vascular amyloid peptide PreA4 Protease nexin-II APPI Amyloid precursor protein Amyloid-beta A4 protein Alzheimer disease amyloid A4 protein homolog Amyloid-beta (A4) precursor protein protein protein human Homo sapiens Human DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV 672 711 D563D7858C3768F1 app-app-86 2 3 unspecified role unspecified role unspecified role unspecified role P05067-PRO_0000000093:p.Asp23Asn D23N mutation mutation certain certain sequence position certain certain certain sequence position certain D N This feature has been corrected as a result of our quality control procedures. The original label was 'D23N'. Wed May 02 19:06:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp23asn' Tue Jun 30 19:27:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp23Asn' chemical synthesis Chemical synthesis (Chemical synthesis) 3 unspecified role unspecified role unspecified role unspecified role P05067-PRO_0000000093:p.Asp23Asn D23N mutation mutation certain certain sequence position certain certain certain sequence position certain D N This feature has been corrected as a result of our quality control procedures. The original label was 'D23N'. Wed May 02 19:06:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp23asn' Tue Jun 30 18:26:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp23Asn' chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction app-app-87 1 3 unspecified role unspecified role unspecified role unspecified role P05067-PRO_0000000093:p.Asp23Asn D23N mutation mutation certain certain sequence position certain certain certain sequence position certain D N This feature has been corrected as a result of our quality control procedures. The original label was 'D23N'. Wed May 02 16:54:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp23asn' Tue Jun 30 17:38:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp23Asn' chemical synthesis Chemical synthesis (Chemical synthesis) 3 unspecified role unspecified role unspecified role unspecified role P05067-PRO_0000000093:p.Asp23Asn D23N mutation mutation certain certain sequence position certain certain certain sequence position certain D N This feature has been corrected as a result of our quality control procedures. The original label was 'D23N'. Wed May 02 16:54:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp23asn' Tue Jun 30 15:38:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp23Asn' chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction