DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu AMBRA1 links autophagy to cell proliferation and tumorigenesis by promoting c-Myc dephosphorylation and degradation. AMBRA1 links autophagy to cell proliferation and tumorigenesis by promoting c-Myc dephosphorylation and degradation. Nature cell biology 2015 imex curation Cianfanelli V., Fuoco C., Lorente M., Salazar M., Quondamatteo F., Gherardini PF., De Zio D., Nazio F., Antonioli M., D'Orazio M., Skobo T., Bordi M., Rohde M., Dalla Valle L., Helmer-Citterich M., Gretzmeier C., Dengjel J., Fimia GM., Piacentini M., Di Bartolomeo S., Velasco G., Cecconi F. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Cianfanelli V., Fuoco C., Lorente M., Salazar M., Quondamatteo F., Gherardini PF., De Zio D., Nazio F., Antonioli M., D'Orazio M., Skobo T., Bordi M., Rohde M., Dalla Valle L., Helmer-Citterich M., Gretzmeier C., Dengjel J., Fimia GM., Piacentini M., Di Bartolomeo S., Velasco G., Cecconi F. DIP original experiment: DIP-265728X Nature cell biology 2015 IMEx AMBRA1 links autophagy to cell proliferation and tumorigenesis by promoting c-Myc dephosphorylation and degradation. AMBRA1 links autophagy to cell proliferation and tumorigenesis by promoting c-Myc dephosphorylation and degradation. AMBRA1 links autophagy to cell proliferation and tumorigenesis by promoting c-Myc dephosphorylation and degradation. Nature cell biology 2015 imex curation Cianfanelli V., Fuoco C., Lorente M., Salazar M., Quondamatteo F., Gherardini PF., De Zio D., Nazio F., Antonioli M., D'Orazio M., Skobo T., Bordi M., Rohde M., Dalla Valle L., Helmer-Citterich M., Gretzmeier C., Dengjel J., Fimia GM., Piacentini M., Di Bartolomeo S., Velasco G., Cecconi F. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Cianfanelli V., Fuoco C., Lorente M., Salazar M., Quondamatteo F., Gherardini PF., De Zio D., Nazio F., Antonioli M., D'Orazio M., Skobo T., Bordi M., Rohde M., Dalla Valle L., Helmer-Citterich M., Gretzmeier C., Dengjel J., Fimia GM., Piacentini M., Di Bartolomeo S., Velasco G., Cecconi F. DIP original experiment: DIP-265725X Nature cell biology 2015 IMEx AMBRA1 links autophagy to cell proliferation and tumorigenesis by promoting c-Myc dephosphorylation and degradation. AMBRA1 links autophagy to cell proliferation and tumorigenesis by promoting c-Myc dephosphorylation and degradation. AMBRA1 links autophagy to cell proliferation and tumorigenesis by promoting c-Myc dephosphorylation and degradation. Nature cell biology 2015 imex curation Cianfanelli V., Fuoco C., Lorente M., Salazar M., Quondamatteo F., Gherardini PF., De Zio D., Nazio F., Antonioli M., D'Orazio M., Skobo T., Bordi M., Rohde M., Dalla Valle L., Helmer-Citterich M., Gretzmeier C., Dengjel J., Fimia GM., Piacentini M., Di Bartolomeo S., Velasco G., Cecconi F. Only protein-protein interactions human Homo sapiens Human molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Cianfanelli V., Fuoco C., Lorente M., Salazar M., Quondamatteo F., Gherardini PF., De Zio D., Nazio F., Antonioli M., D'Orazio M., Skobo T., Bordi M., Rohde M., Dalla Valle L., Helmer-Citterich M., Gretzmeier C., Dengjel J., Fimia GM., Piacentini M., Di Bartolomeo S., Velasco G., Cecconi F. DIP original experiment: DIP-265727X Nature cell biology 2015 IMEx AMBRA1 links autophagy to cell proliferation and tumorigenesis by promoting c-Myc dephosphorylation and degradation. AMBRA1 links autophagy to cell proliferation and tumorigenesis by promoting c-Myc dephosphorylation and degradation. AMBRA1 links autophagy to cell proliferation and tumorigenesis by promoting c-Myc dephosphorylation and degradation. Nature cell biology 2015 imex curation Cianfanelli V., Fuoco C., Lorente M., Salazar M., Quondamatteo F., Gherardini PF., De Zio D., Nazio F., Antonioli M., D'Orazio M., Skobo T., Bordi M., Rohde M., Dalla Valle L., Helmer-Citterich M., Gretzmeier C., Dengjel J., Fimia GM., Piacentini M., Di Bartolomeo S., Velasco G., Cecconi F. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Cianfanelli V., Fuoco C., Lorente M., Salazar M., Quondamatteo F., Gherardini PF., De Zio D., Nazio F., Antonioli M., D'Orazio M., Skobo T., Bordi M., Rohde M., Dalla Valle L., Helmer-Citterich M., Gretzmeier C., Dengjel J., Fimia GM., Piacentini M., Di Bartolomeo S., Velasco G., Cecconi F. DIP original experiment: DIP-265731X Nature cell biology 2015 IMEx AMBRA1 links autophagy to cell proliferation and tumorigenesis by promoting c-Myc dephosphorylation and degradation. AMBRA1 links autophagy to cell proliferation and tumorigenesis by promoting c-Myc dephosphorylation and degradation. AMBRA1 links autophagy to cell proliferation and tumorigenesis by promoting c-Myc dephosphorylation and degradation. Nature cell biology 2015 imex curation Cianfanelli V., Fuoco C., Lorente M., Salazar M., Quondamatteo F., Gherardini PF., De Zio D., Nazio F., Antonioli M., D'Orazio M., Skobo T., Bordi M., Rohde M., Dalla Valle L., Helmer-Citterich M., Gretzmeier C., Dengjel J., Fimia GM., Piacentini M., Di Bartolomeo S., Velasco G., Cecconi F. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Cianfanelli V., Fuoco C., Lorente M., Salazar M., Quondamatteo F., Gherardini PF., De Zio D., Nazio F., Antonioli M., D'Orazio M., Skobo T., Bordi M., Rohde M., Dalla Valle L., Helmer-Citterich M., Gretzmeier C., Dengjel J., Fimia GM., Piacentini M., Di Bartolomeo S., Velasco G., Cecconi F. DIP original experiment: DIP-265726X Nature cell biology 2015 IMEx AMBRA1 links autophagy to cell proliferation and tumorigenesis by promoting c-Myc dephosphorylation and degradation. AMBRA1 links autophagy to cell proliferation and tumorigenesis by promoting c-Myc dephosphorylation and degradation. AMBRA1 links autophagy to cell proliferation and tumorigenesis by promoting c-Myc dephosphorylation and degradation. Nature cell biology 2015 imex curation Cianfanelli V., Fuoco C., Lorente M., Salazar M., Quondamatteo F., Gherardini PF., De Zio D., Nazio F., Antonioli M., D'Orazio M., Skobo T., Bordi M., Rohde M., Dalla Valle L., Helmer-Citterich M., Gretzmeier C., Dengjel J., Fimia GM., Piacentini M., Di Bartolomeo S., Velasco G., Cecconi F. Only protein-protein interactions human Homo sapiens Human tap tandem affinity purification TAP TAP tap de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence Cianfanelli V., Fuoco C., Lorente M., Salazar M., Quondamatteo F., Gherardini PF., De Zio D., Nazio F., Antonioli M., D'Orazio M., Skobo T., Bordi M., Rohde M., Dalla Valle L., Helmer-Citterich M., Gretzmeier C., Dengjel J., Fimia GM., Piacentini M., Di Bartolomeo S., Velasco G., Cecconi F. DIP original experiment: DIP-265729X Nature cell biology 2015 IMEx AMBRA1 links autophagy to cell proliferation and tumorigenesis by promoting c-Myc dephosphorylation and degradation. AMBRA1 links autophagy to cell proliferation and tumorigenesis by promoting c-Myc dephosphorylation and degradation. AMBRA1 links autophagy to cell proliferation and tumorigenesis by promoting c-Myc dephosphorylation and degradation. Nature cell biology 2015 imex curation Cianfanelli V., Fuoco C., Lorente M., Salazar M., Quondamatteo F., Gherardini PF., De Zio D., Nazio F., Antonioli M., D'Orazio M., Skobo T., Bordi M., Rohde M., Dalla Valle L., Helmer-Citterich M., Gretzmeier C., Dengjel J., Fimia GM., Piacentini M., Di Bartolomeo S., Velasco G., Cecconi F. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Cianfanelli V., Fuoco C., Lorente M., Salazar M., Quondamatteo F., Gherardini PF., De Zio D., Nazio F., Antonioli M., D'Orazio M., Skobo T., Bordi M., Rohde M., Dalla Valle L., Helmer-Citterich M., Gretzmeier C., Dengjel J., Fimia GM., Piacentini M., Di Bartolomeo S., Velasco G., Cecconi F. DIP original experiment: DIP-265730X Nature cell biology 2015 IMEx AMBRA1 links autophagy to cell proliferation and tumorigenesis by promoting c-Myc dephosphorylation and degradation. ulk1_human Serine/threonine-protein kinase ULK1 ULK1 KIAA0722 Unc-51-like kinase 1 Autophagy-related protein 1 homolog protein protein human Homo sapiens Human MEPGRGGTETVGKFEFSRKDLIGHGAFAVVFKGRHREKHDLEVAVKCINKKNLAKSQTLLGKEIKILKELKHENIVALYDFQEMANSVYLVMEYCNGGDLADYLHAMRTLSEDTIRLFLQQIAGAMRLLHSKGIIHRDLKPQNILLSNPAGRRANPNSIRVKIADFGFARYLQSNMMAATLCGSPMYMAPEVIMSQHYDGKADLWSIGTIVYQCLTGKAPFQASSPQDLRLFYEKNKTLVPTIPRETSAPLRQLLLALLQRNHKDRMDFDEFFHHPFLDASPSVRKSPPVPVPSYPSSGSGSSSSSSSTSHLASPPSLGEMQQLQKTLASPADTAGFLHSSRDSGGSKDSSCDTDDFVMVPAQFPGDLVAEAPSAKPPPDSLMCSGSSLVASAGLESHGRTPSPSPPCSSSPSPSGRAGPFSSSRCGASVPIPVPTQVQNYQRIERNLQSPTQFQTPRSSAIRRSGSTSPLGFARASPSPPAHAEHGGVLARKMSLGGGRPYTPSPQVGTIPERPGWSGTPSPQGAEMRGGRSPRPGSSAPEHSPRTSGLGCRLHSAPNLSDLHVVRPKLPKPPTDPLGAVFSPPQASPPQPSHGLQSCRNLRGSPKLPDFLQRNPLPPILGSPTKAVPSFDFPKTPSSQNLLALLARQGVVMTPPRNRTLPDLSEVGPFHGQPLGPGLRPGEDPKGPFGRSFSTSRLTDLLLKAAFGTQAPDPGSTESLQEKPMEIAPSAGFGGSLHPGARAGGTSSPSPVVFTVGSPPSGSTPPQGPRTRMFSAGPTGSASSSARHLVPGPCSEAPAPELPAPGHGCSFADPITANLEGAVTFEAPDLPEETLMEQEHTEILRGLRFTLLFVQHVLEIAALKGSASEAAGGPEYQLQESVVADQISLLSREWGFAEQLVLYLKVAELLSSGLQSAIDQIRAGKLCLSSTVKQVVRRLNELYKASVVSCQGLSLRLQRFFLDKQRLLDRIHSITAERLIFSHAVQMVQSAALDEMFQHREGCVPRYHKALLLLEGLQHMLSDQADIENVTKCKLCIERRLSALLTGICA DIP protein O75385 original sequence version: 129 DIP protein O75385 original sequence version: 141 DIP protein O75385 original sequence version: 133 DIP protein O75385 original sequence version: 132 DIP protein O75385 original sequence version: 142 AED9BD5139F2DB92 2aaa_human Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform PPP2R1A PP2A subunit A isoform PR65-alpha PP2A subunit A isoform R1-alpha Medium tumor antigen-associated 61 kDa protein protein protein human Homo sapiens Human MAAADGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLALAEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHSPSDLEAHFVPLVKRLAGGDWFTSRTSACGLFSVCYPRVSSAVKAELRQYFRNLCSDDTPMVRRAAASKLGEFAKVLELDNVKSEIIPMFSNLASDEQDSVRLLAVEACVNIAQLLPQEDLEALVMPTLRQAAEDKSWRVRYMVADKFTELQKAVGPEITKTDLVPAFQNLMKDCEAEVRAAASHKVKEFCENLSADCRENVIMSQILPCIKELVSDANQHVKSALASVIMGLSPILGKDNTIEHLLPLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATSNLKKLVEKFGKEWAHATIIPKVLAMSGDPNYLHRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNVAKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEALTVLSLA DIP protein P30153 original sequence version: 153 DIP protein P30153 original sequence version: 71 DIP protein P30153 original sequence version: 105 DIP protein P30153 original sequence version: 107 DIP protein P30153 original sequence version: 151 DIP protein P30153 original sequence version: 156 DIP protein P30153 original sequence version: 155 DIP protein P30153 original sequence version: 169 5174EBE94D537836 myc_human Myc proto-oncogene protein BHLHE39 Transcription factor p64 MYC Proto-oncogene c-Myc Class E basic helix-loop-helix protein 39 protein protein human Homo sapiens Human MPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPPLSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPDDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPNPARGHSVCSTSSLYLQDLSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLSSTESSPQGSPEPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAGGHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSPRSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA DIP protein P01106 original sequence version: 195 DIP protein P01106 original sequence version: 196 DIP protein P01106 original sequence version: 148 DIP protein P01106-1 original sequence version: 161 DIP protein P01106 original sequence version: 182 DIP protein P01106 original sequence version: 197 DIP protein P01106-1 original sequence version: 208 DIP protein P01106 original sequence version: 121 DIP protein P01106-1 original sequence version: 144 DIP protein P01106 original sequence version: 144 ED5C028029A4C5D1 becn1_human Beclin-1 Coiled-coil myosin-like BCL2-interacting protein Protein GT197 BECN1 GT197 protein protein human Homo sapiens Human MEGSKTSNNSTMQVSFVCQRCSQPLKLDTSFKILDRVTIQELTAPLLTTAQAKPGETQEEETNSGEEPFIETPRQDGVSRRFIPPARMMSTESANSFTLIGEASDGGTMENLSRRLKVTGDLFDIMSGQTDVDHPLCEECTDTLLDQLDTQLNVTENECQNYKRCLEILEQMNEDDSEQLQMELKELALEEERLIQELEDVEKNRKIVAENLEKVQAEAERLDQEEAQYQREYSEFKRQQLELDDELKSVENQMRYAQTQLDKLKKTNVFNATFHIWHSGQFGTINNFRLGRLPSVPVEWNEINAAWGQTVLLLHALANKMGLKFQRYRLVPYGNHSYLESLTDKSKELPLYCSGGLRFFWDNKFDHAMVAFLDCVQQFKEEVEKGETRFCLPYRMDVEKGKIEDTGGSGGSYSIKTQFNSEEQWTKALKFMLTNLKWGLAWVSSQFYNK DIP protein Q14457 original sequence version: 95 DIP protein Q14457 original sequence version: 156 DIP protein Q14457 original sequence version: 122 DIP protein Q14457 original sequence version: 120 DIP protein Q14457 original sequence version: 133 DIP protein Q14457 original sequence version: 141 DIP protein Q14457 original sequence version: 106 ABF0C2DD7087473C amra1_human Activating molecule in BECN1-regulated autophagy protein 1 AMBRA1 DCAF3 DDB1- and CUL4-associated factor 3 KIAA1736 protein protein human Homo sapiens Human MKVVPEKNAVRILWGRERGARAMGAQRLLQELVEDKTRWMKWEGKRVELPDSPRSTFLLAFSPDRTLLASTHVNHNIYITEVKTGKCVHSLIGHRRTPWCVTFHPTISGLIASGCLDGEVRIWDLHGGSESWFTDSNNAIASLAFHPTAQLLLIATANEIHFWDWSRREPFAVVKTASEMERVRLVRFDPLGHYLLTAIVNPSNQQGDDEPEIPIDGTELSHYRQRALLQSQPVRRTPLLHNFLHMLSSRSSGIQVGEQSTVQDSATPSPPPPPPQPSTERPRTSAYIRLRQRVSYPTAECCQHLGILCLCSRCSGTRVPSLLPHQDSVPPASARATTPSFSFVQTEPFHPPEQASSTQQDQGLLNRPSAFSTVQSSTAGNTLRNLSLGPTRRSLGGPLSSHPSRYHREIAPGLTGSEWTRTVLSLNSRSEAESMPPPRTSASSVSLLSVLRQQEGGSQASVYTSATEGRGFPASGLATESDGGNGSSQNNSGSIRHELQCDLRRFFLEYDRLQELDQSLSGEAPQTQQAQEMLNNNIESERPGPSHQPTPHSSENNSNLSRGHLNRCRACHNLLTFNNDTLRWERTTPNYSSGEASSSWQVPSSFESVPSSGSQLPPLERTEGQTPSSSRLELSSSASPQEERTVGVAFNQETGHWERIYTQSSRSGTVSQEALHQDMPEESSEEDSLRRRLLESSLISLSRYDGAGSREHPIYPDPARLSPAAYYAQRMIQYLSRRDSIRQRSMRYQQNRLRSSTSSSSSDNQGPSVEGTDLEFEDFEDNGDRSRHRAPRNARMSAPSLGRFVPRRFLLPEYLPYAGIFHERGQPGLATHSSVNRVLAGAVIGDGQSAVASNIANTTYRLQWWDFTKFDLPEISNASVNVLVQNCKIYNDASCDISADGQLLAAFIPSSQRGFPDEGILAVYSLAPHNLGEMLYTKRFGPNAISVSLSPMGRYVMVGLASRRILLHPSTEHMVAQVFRLQQAHGGETSMRRVFNVLYPMPADQRRHVSINSARWLPEPGLGLAYGTNKGDLVICRPEALNSGVEYYWDQLNETVFTVHSNSRSSERPGTSRATWRTDRDMGLMNAIGLQPRNPATSVTSQGTQTLALQLQNAETQTEREVPEPGTAASGPGEGEGSEYGASGEDALSRIQRLMAEGGMTAVVQREQSTTMASMGGFGNNIIVSHRIHRSSQTGTEPGAAHTSSPQPSTSRGLLPEAGQLAERGLSPRTASWDQPGTPGREPTQPTLPSSSPVPIPVSLPSAEGPTLHCELTNNNHLLDGGSSRGDAAGPRGEPRNR DIP protein Q9C0C7 original sequence version: 104 DIP protein Q9C0C7 original sequence version: 96 44FE9CDFFFE6811E pp2aa_human Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform PPP2CA Replication protein C protein protein human Homo sapiens Human MDEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL DIP protein P67775 original sequence version: 112 DIP protein P67775-1 original sequence version: 98 DIP protein P67775 original sequence version: 29 DIP protein P67775 original sequence version: 102 DIP protein P67775 original sequence version: 65 DIP protein P67775 original sequence version: 67 DIP protein P67775-1 original sequence version: 114 DIP protein P67775 original sequence version: 113 DIP protein P67775-1 original sequence version: 122 C602291F78F34555 ulk1-ambra1-1 7 8 unspecified role unspecified role bait bait human Homo sapiens Human 12 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association ambra1-ppp2ca-1 2 13 unspecified role unspecified role prey prey Region 169-309 Region 169-309 sufficient to bind sufficient binding region sufficient to bind full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 12 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association myc-ambra1-1 1 10 unspecified role unspecified role bait bait human Homo sapiens Human 12 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association ppp2r1a-ambra1-1 5 9 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 12 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association becn1-ambra1-3 4 11 unspecified role unspecified role bait bait human Homo sapiens Human 12 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association ambra1-ppp2r1a-1 6 9 unspecified role unspecified role prey prey human Homo sapiens Human 12 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association ambra1-ppp2r1a-2 3 9 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 12 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human physical association physical association