DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Intrinsic disorder drives N-terminal ubiquitination by Ube2w. Intrinsic disorder drives N-terminal ubiquitination by Ube2w. Nature chemical biology 2015 imex curation Vittal V., Shi L., Wenzel DM., Scaglione KM., Duncan ED., Basrur V., Elenitoba-Johnson KS., Baker D., Paulson HL., Brzovic PS., Klevit RE. Only protein-protein interactions in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Vittal V., Shi L., Wenzel DM., Scaglione KM., Duncan ED., Basrur V., Elenitoba-Johnson KS., Baker D., Paulson HL., Brzovic PS., Klevit RE. DIP original experiment: DIP-266206X Nature chemical biology 2015 IMEx Intrinsic disorder drives N-terminal ubiquitination by Ube2w. rpab3_human DNA-directed RNA polymerases I, II, and III subunit RPABC3 POLR2H DNA-directed RNA polymerase II subunit H DNA-directed RNA polymerases I, II, and III 17.1 kDa polypeptide RPB17 RPB8 homolog protein protein human Homo sapiens Human MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVIASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGGLLMRLQGDANNLHGFEVDSRVYLLMKKLAF DIP protein P52434 original sequence version: 102 DIP protein P52434-1 original sequence version: 152 DIP protein P52434 original sequence version: 167 944D0860809F1425 q96b02-1 Ubiquitin-conjugating enzyme E2 W UBE2W UBC16 E2 ubiquitin-conjugating enzyme W N-terminal E2 ubiquitin-conjugating enzyme N-terminus-conjugating E2 Ubiquitin carrier protein W Ubiquitin-conjugating enzyme 16 Ubiquitin-protein ligase W protein protein human Homo sapiens Human MASMQKRLQKELLALQNDPPPGMTLNEKSVQNSITQWIVDMEGAPGTLYEGEKFQLLFKFSSRYPFDSPQVMFTGENIPVHPHVYSNGHICLSILTEDWSPALSVQSVCLSIISMLSSCKEKRRPPDNSFYVRTCNKNPKKTKWWYHDDTC DIP protein Q96B02-1 original sequence version: 125 polr2h-ube2w-1 1 2 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 3 unspecified role unspecified role unspecified role unspecified role Q96B02-1:p.[Val30Lys;Asp67Lys] V30K/D67K mutation mutation certain certain sequence position certain certain certain sequence position certain D K certain certain sequence position certain certain certain sequence position certain V K This feature has been corrected as a result of our quality control procedures. The original label was 'V30K/D67K'. Wed May 02 17:47:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val30lys,asp67lys' Tue Jun 30 19:29:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Val30Lys;Asp67Lys]' ecolx Escherichia coli direct interaction direct interaction