DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu O-GlcNAc-modification of SNAP-29 regulates autophagosome maturation. O-GlcNAc-modification of SNAP-29 regulates autophagosome maturation. Nature cell biology 2014 imex curation Guo B., Liang Q., Li L., Hu Z., Wu F., Zhang P., Ma Y., Zhao B., Kovács AL., Zhang Z., Feng D., Chen S., Zhang H. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Guo B., Liang Q., Li L., Hu Z., Wu F., Zhang P., Ma Y., Zhao B., Kovács AL., Zhang Z., Feng D., Chen S., Zhang H. DIP original experiment: DIP-264668X Nature cell biology 2014 IMEx O-GlcNAc-modification of SNAP-29 regulates autophagosome maturation. O-GlcNAc-modification of SNAP-29 regulates autophagosome maturation. O-GlcNAc-modification of SNAP-29 regulates autophagosome maturation. Nature cell biology 2014 imex curation Guo B., Liang Q., Li L., Hu Z., Wu F., Zhang P., Ma Y., Zhao B., Kovács AL., Zhang Z., Feng D., Chen S., Zhang H. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Guo B., Liang Q., Li L., Hu Z., Wu F., Zhang P., Ma Y., Zhao B., Kovács AL., Zhang Z., Feng D., Chen S., Zhang H. DIP original experiment: DIP-264675X Nature cell biology 2014 IMEx O-GlcNAc-modification of SNAP-29 regulates autophagosome maturation. O-GlcNAc-modification of SNAP-29 regulates autophagosome maturation. O-GlcNAc-modification of SNAP-29 regulates autophagosome maturation. Nature cell biology 2014 imex curation Guo B., Liang Q., Li L., Hu Z., Wu F., Zhang P., Ma Y., Zhao B., Kovács AL., Zhang Z., Feng D., Chen S., Zhang H. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Guo B., Liang Q., Li L., Hu Z., Wu F., Zhang P., Ma Y., Zhao B., Kovács AL., Zhang Z., Feng D., Chen S., Zhang H. DIP original experiment: DIP-264678X Nature cell biology 2014 IMEx O-GlcNAc-modification of SNAP-29 regulates autophagosome maturation. O-GlcNAc-modification of SNAP-29 regulates autophagosome maturation. O-GlcNAc-modification of SNAP-29 regulates autophagosome maturation. Nature cell biology 2014 imex curation Guo B., Liang Q., Li L., Hu Z., Wu F., Zhang P., Ma Y., Zhao B., Kovács AL., Zhang Z., Feng D., Chen S., Zhang H. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Guo B., Liang Q., Li L., Hu Z., Wu F., Zhang P., Ma Y., Zhao B., Kovács AL., Zhang Z., Feng D., Chen S., Zhang H. DIP original experiment: DIP-264671X Nature cell biology 2014 IMEx O-GlcNAc-modification of SNAP-29 regulates autophagosome maturation. O-GlcNAc-modification of SNAP-29 regulates autophagosome maturation. O-GlcNAc-modification of SNAP-29 regulates autophagosome maturation. Nature cell biology 2014 imex curation Guo B., Liang Q., Li L., Hu Z., Wu F., Zhang P., Ma Y., Zhao B., Kovács AL., Zhang Z., Feng D., Chen S., Zhang H. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Guo B., Liang Q., Li L., Hu Z., Wu F., Zhang P., Ma Y., Zhao B., Kovács AL., Zhang Z., Feng D., Chen S., Zhang H. DIP original experiment: DIP-264673X Nature cell biology 2014 IMEx O-GlcNAc-modification of SNAP-29 regulates autophagosome maturation. O-GlcNAc-modification of SNAP-29 regulates autophagosome maturation. O-GlcNAc-modification of SNAP-29 regulates autophagosome maturation. Nature cell biology 2014 imex curation Guo B., Liang Q., Li L., Hu Z., Wu F., Zhang P., Ma Y., Zhao B., Kovács AL., Zhang Z., Feng D., Chen S., Zhang H. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Guo B., Liang Q., Li L., Hu Z., Wu F., Zhang P., Ma Y., Zhao B., Kovács AL., Zhang Z., Feng D., Chen S., Zhang H. DIP original experiment: DIP-264677X Nature cell biology 2014 IMEx O-GlcNAc-modification of SNAP-29 regulates autophagosome maturation. O-GlcNAc-modification of SNAP-29 regulates autophagosome maturation. O-GlcNAc-modification of SNAP-29 regulates autophagosome maturation. Nature cell biology 2014 imex curation Guo B., Liang Q., Li L., Hu Z., Wu F., Zhang P., Ma Y., Zhao B., Kovács AL., Zhang Z., Feng D., Chen S., Zhang H. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Guo B., Liang Q., Li L., Hu Z., Wu F., Zhang P., Ma Y., Zhao B., Kovács AL., Zhang Z., Feng D., Chen S., Zhang H. DIP original experiment: DIP-264674X Nature cell biology 2014 IMEx O-GlcNAc-modification of SNAP-29 regulates autophagosome maturation. O-GlcNAc-modification of SNAP-29 regulates autophagosome maturation. O-GlcNAc-modification of SNAP-29 regulates autophagosome maturation. Nature cell biology 2014 imex curation Guo B., Liang Q., Li L., Hu Z., Wu F., Zhang P., Ma Y., Zhao B., Kovács AL., Zhang Z., Feng D., Chen S., Zhang H. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Guo B., Liang Q., Li L., Hu Z., Wu F., Zhang P., Ma Y., Zhao B., Kovács AL., Zhang Z., Feng D., Chen S., Zhang H. DIP original experiment: DIP-264676X Nature cell biology 2014 IMEx O-GlcNAc-modification of SNAP-29 regulates autophagosome maturation. O-GlcNAc-modification of SNAP-29 regulates autophagosome maturation. O-GlcNAc-modification of SNAP-29 regulates autophagosome maturation. Nature cell biology 2014 imex curation Guo B., Liang Q., Li L., Hu Z., Wu F., Zhang P., Ma Y., Zhao B., Kovács AL., Zhang Z., Feng D., Chen S., Zhang H. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Guo B., Liang Q., Li L., Hu Z., Wu F., Zhang P., Ma Y., Zhao B., Kovács AL., Zhang Z., Feng D., Chen S., Zhang H. DIP original experiment: DIP-264670X Nature cell biology 2014 IMEx O-GlcNAc-modification of SNAP-29 regulates autophagosome maturation. O-GlcNAc-modification of SNAP-29 regulates autophagosome maturation. O-GlcNAc-modification of SNAP-29 regulates autophagosome maturation. Nature cell biology 2014 imex curation Guo B., Liang Q., Li L., Hu Z., Wu F., Zhang P., Ma Y., Zhao B., Kovács AL., Zhang Z., Feng D., Chen S., Zhang H. Only protein-protein interactions caeel Caenorhabditis elegans anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Guo B., Liang Q., Li L., Hu Z., Wu F., Zhang P., Ma Y., Zhao B., Kovács AL., Zhang Z., Feng D., Chen S., Zhang H. DIP original experiment: DIP-264672X Nature cell biology 2014 IMEx O-GlcNAc-modification of SNAP-29 regulates autophagosome maturation. O-GlcNAc-modification of SNAP-29 regulates autophagosome maturation. O-GlcNAc-modification of SNAP-29 regulates autophagosome maturation. Nature cell biology 2014 imex curation Guo B., Liang Q., Li L., Hu Z., Wu F., Zhang P., Ma Y., Zhao B., Kovács AL., Zhang Z., Feng D., Chen S., Zhang H. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Guo B., Liang Q., Li L., Hu Z., Wu F., Zhang P., Ma Y., Zhao B., Kovács AL., Zhang Z., Feng D., Chen S., Zhang H. DIP original experiment: DIP-264669X Nature cell biology 2014 IMEx O-GlcNAc-modification of SNAP-29 regulates autophagosome maturation. sna29_caeel Soluble NSF attachment protein 29 phi-28 K02D10.5 snap-29 protein protein caeel Caenorhabditis elegans MSRNPFDDDYRPSAASSTMPVKSYTTMGHYSGEDEADYYEREIEKTLQESLDSTERSRRHLENSEKIGTSTAQQLLEQREKLENTEKNLDEIHRTTQMTQRNLNSLKSFFGGMFKNKFTKKPQEPTETPTVPQSKSASRLSETATNLSSGGGSATFSGPSGQRTLTESSRSAIKGTRWEAMDNQIDENLDMMSANLRNLQRLGADLGKEVDSQNEMLDRIQYKAERNDGIVRDQDKQMQKILGTGASTSQTTAESLTPSMDTSTKMSLMMKATSLWK DIP protein P83351 original sequence version: 87 ogt1_human UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit O-linked N-acetylglucosamine transferase 110 kDa subunit O-GlcNAc transferase subunit p110 OGT protein protein human Homo sapiens Human MASSVGNVADSTEPTKRMLSFQGLAELAHREYQAGDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKSNGHIYDNRIVLNGIDLKAFLDSLPDVKIVKMKCPDGGDNADSSNTALNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIKPVEVTESA DIP protein O15294 original sequence version: 165 DIP protein O15294 original sequence version: 147 852ED68BDDE63363 ogt1_caeel UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase K04G7.3 O-GlcNAc OGT ogt-1 protein protein caeel Caenorhabditis elegans MEKPNYFQSYNKVIGATGEQLAPGAVPPHPVLAPSIAPGGVAGVSAANMANIMQTPGFANLVQQAIRTQLENQAAQQLAVNQQFQLNGATAVQQQLLLTPQQSLAQPIALAPQPTVVLNGVSETLKKVTELAHRQFQSGNYVEAEKYCNLVFQSDPNNLPTLLLLSAINFQTKNLEKSMQYSMLAIKVNNQCAEAYSNLGNYYKEKGQLQDALENYKLAVKLKPEFIDAYINLAAALVSGGDLEQAVTAYFNALQINPDLYCVRSDLGNLLKAMGRLEEAKVCYLKAIETQPQFAVAWSNLGCVFNSQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVSAYLRALNLSGNHAVVHGNLACVYYEQGLIDLAIDTYKKAIDLQPHFPDAYCNLANALKEKGSVVEAEQMYMKALELCPTHADSQNNLANIKREQGKIEDATRLYLKALEIYPEFAAAHSNLASILQQQGKLNDAILHYKEAIRIAPTFADAYSNMGNTLKEMGDSSAAIACYNRAIQINPAFADAHSNLASIHKDAGNMAEAIQSYSTALKLKPDFPDAYCNLAHCHQIICDWNDYDKRVRKLVQIVEDQLCKKRLPSVHPHHSMLYPLSHAARIAIAAKHASLCFDKVHVQMLGKTPLIHADRFSVQNGQRLRIGYVSSDFGNHPTSHLMQSIPGMHDRSRVEVFCYALSVNDGTNFRSKLMNESEHFVDLSQIPCNGKAAEKIAQDGIHILINMNGYTKGARNEIFALRPAPIQVMWLGYPSTSGATFMDYIITDAVTSPLRLANAFTEKLAYMPHTFFIGDHAQMLRHLTDKVVVKDKETTERDSCLIMNTANMDPILAKSEIKEQVLDTEVVSGPNKELVRAEMVLPVLEVPTEPIKQMIMTGQMTMNVMEDMNVQNGLGQSQMHHKAATGEEIPNSVLLTSRAQYQLPDDAIVFCNFNQLYKIDPSTLDMWIKILENVPKSILWLLRFPYQGEEHIRKYCVERGLDPSRIVFSNVAAKEEHVRRGQLADVCLDTPLCNGHTTGMDILWTGTPMVTMPLESLASRVATSQLYALGVPELVAKTRQEYVSIAVRLGTDADHLANMRAKVWMARTSSTLFDVKQYCHDMEDLLGQMWKRYESGMPIDHITNNTETPHGL DIP protein O18158 original sequence version: 114 D1CE2A19401CC44F stx17_human Syntaxin-17 STX17 protein protein human Homo sapiens Human MSEDEEKVKLRRLEPAIQKFIKIVIPTDLERLRKHQINIEKYQRCRIWDKLHEEHINAGRTVQQLRSNIREIEKLCLKVRKDDLVLLKRMIDPVKEEASAATAEFLQLHLESVEELKKQFNDEETLLQPPLTRSMTVGGAFHTTEAEASSQSLTQIYALPEIPQDQNAAESWETLEADLIELSQLVTDFSLLVNSQQEKIDSIADHVNSAAVNVEEGTKNLGKAAKYKLAALPVAGALIGGMVGGPIGLLAGFKVAGIAAALGGGVLGFTGGKLIQRKKQKMMEKLTSSCPDLPSQTDKKCS DIP protein P56962 original sequence version: 116 DIP protein P56962 original sequence version: 86 51AD5427EFBAC541 stx6_human Syntaxin-6 STX6 protein protein human Homo sapiens Human MSMEDPFFVVKGEVQKAVNTAQGLFQRWTELLQDPSTATREEIDWTTNELRNNLRSIEWDLEDLDETISIVEANPRKFNLDATELSIRKAFITSTRQVVRDMKDQMSTSSVQALAERKNRQALLGDSGSQNWSTGTTDKYGRLDRELQRANSHFIEEQQAQQQLIVEQQDEQLELVSGSIGVLKNMSQRIGGELEEQAVMLEDFSHELESTQSRLDNVMKKLAKVSHMTSDRRQWCAIAILFAVLLVVLILFLVL DIP protein O43752 original sequence version: 117 DIP protein O43752 original sequence version: 129 DIP protein O43752 original sequence version: 134 CC05C025DE1FE89E vamp4_human Vesicle-associated membrane protein 4 VAMP4 protein protein human Homo sapiens Human MPPKFKRHLNDDDVTGSVKSERRNLLEDDSDEEEDFFLRGPSGPRFGPRNDKIKHVQNQVDEVIDVMQENITKVIERGERLDELQDKSESLSDNATAFSNRSKQLRRQMWWRGCKIKAIMALVAAILLLVIIILIVMKYRT DIP protein O75379 original sequence version: 118 DIP protein O75379 original sequence version: 128 DIP protein O75379 original sequence version: 133 556CC682D26CF91E vamp8_human Vesicle-associated membrane protein 8 Endobrevin VAMP8 protein protein human Homo sapiens Human MEEASEGGGNDRVRNLQSEVEGVKNIMTQNVERILARGENLEHLRNKTEDLEATSEHFKTTSQKVARKFWWKNVKMIVLICVIVFIIILFIVLFATGAFS DIP protein Q9BV40 original sequence version: 108 DIP protein Q9BV40 original sequence version: 118 DIP protein Q9BV40 original sequence version: 100 018B986442BBD9B6 snp29_human Synaptosomal-associated protein 29 Vesicle-membrane fusion protein SNAP-29 Soluble 29 kDa NSF attachment protein SNAP29 protein protein human Homo sapiens Human MSAYPKSYNPFDDDGEDEGARPAPWRDARDLPDGPDAPADRQQYLRQEVLRRAEATAASTSRSLALMYESEKVGVASSEELARQRGVLERTEKMVDKMDQDLKISQKHINSIKSVFGGLVNYFKSKPVETPPEQNGTLTSQPNNRLKEAISTSKEQEAKYQASHPNLRKLDDTDPVPRGAGSAMSTDAYPKNPHLRAYHQKIDSNLDELSMGLGRLKDIALGMQTEIEEQDDILDRLTTKVDKLDVNIKSTERKVRQL DIP protein O95721 original sequence version: 135 DIP protein O95721 original sequence version: 139 DIP protein O95721 original sequence version: 118 7E1CDBA22D6F5A3C snap29-stx6-1 3 19 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 16 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association stx17-snap29-2 1 18 unspecified role unspecified role prey prey human Homo sapiens Human 19 unspecified role unspecified role prey prey human Homo sapiens Human 15 unspecified role unspecified role bait bait human Homo sapiens Human association association stx17-snap29-5 8 15 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 19 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association ogt-snap29-1 9 19 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 13 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association ogt_1-snap_29-1 10 12 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range caeel Caenorhabditis elegans 14 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range caeel Caenorhabditis elegans physical association physical association stx6-vamp4-1 7 16 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 17 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human physical association physical association snap29-stx17-2 11 18 unspecified role unspecified role prey prey human Homo sapiens Human 19 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range O95721:p.[Ser2Ala;Ser61Gly;Thr130Ala;Ser153Gly] S2A/S61G/T130A/S153G mutation increasing strength mutation increasing interaction strength mutation increasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain S G certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain S G certain certain sequence position certain certain certain sequence position certain T A This feature has been corrected as a result of our quality control procedures. The original label was 'S2A/S61G/T130A/S153G'. Wed May 02 15:23:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser2ala,ser61gly,thr130ala,ser153gly' Tue Jun 30 16:25:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser2Ala;Ser61Gly;Thr130Ala;Ser153Gly]' human Homo sapiens Human 15 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human association association stx6-snap29-1 6 19 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 16 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association vamp8-snap29-1 4 18 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 19 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association stx17-snap29-6 5 18 unspecified role unspecified role prey prey human Homo sapiens Human 19 unspecified role unspecified role prey prey human Homo sapiens Human 15 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human association association ogt-snap29-2 2 19 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 13 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association