DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu A DNA damage-induced, SOS-independent checkpoint regulates cell division in Caulobacter crescentus. A DNA damage-induced, SOS-independent checkpoint regulates cell division in Caulobacter crescentus. PLoS biology 2014 imex curation Modell JW., Kambara TK., Perchuk BS., Laub MT. Only protein-protein interactions ecolx Escherichia coli adenylate cyclase adenylate cyclase complementation bacterial two-hybrid bacterial two-hybrid adenylate cyclase predetermined predetermined participant predetermined Modell JW., Kambara TK., Perchuk BS., Laub MT. DIP original experiment: DIP-262266X PLoS biology 2014 IMEx A DNA damage-induced, SOS-independent checkpoint regulates cell division in Caulobacter crescentus. A DNA damage-induced, SOS-independent checkpoint regulates cell division in Caulobacter crescentus. A DNA damage-induced, SOS-independent checkpoint regulates cell division in Caulobacter crescentus. PLoS biology 2014 imex curation Modell JW., Kambara TK., Perchuk BS., Laub MT. Only protein-protein interactions ecolx Escherichia coli adenylate cyclase adenylate cyclase complementation bacterial two-hybrid bacterial two-hybrid adenylate cyclase predetermined predetermined participant predetermined Modell JW., Kambara TK., Perchuk BS., Laub MT. DIP original experiment: DIP-262265X PLoS biology 2014 IMEx A DNA damage-induced, SOS-independent checkpoint regulates cell division in Caulobacter crescentus. A DNA damage-induced, SOS-independent checkpoint regulates cell division in Caulobacter crescentus. A DNA damage-induced, SOS-independent checkpoint regulates cell division in Caulobacter crescentus. PLoS biology 2014 imex curation Modell JW., Kambara TK., Perchuk BS., Laub MT. Only protein-protein interactions ecolx Escherichia coli adenylate cyclase adenylate cyclase complementation bacterial two-hybrid bacterial two-hybrid adenylate cyclase predetermined predetermined participant predetermined Modell JW., Kambara TK., Perchuk BS., Laub MT. DIP original experiment: DIP-262267X PLoS biology 2014 IMEx A DNA damage-induced, SOS-independent checkpoint regulates cell division in Caulobacter crescentus. A DNA damage-induced, SOS-independent checkpoint regulates cell division in Caulobacter crescentus. A DNA damage-induced, SOS-independent checkpoint regulates cell division in Caulobacter crescentus. PLoS biology 2014 imex curation Modell JW., Kambara TK., Perchuk BS., Laub MT. Only protein-protein interactions ecolx Escherichia coli adenylate cyclase adenylate cyclase complementation bacterial two-hybrid bacterial two-hybrid adenylate cyclase predetermined predetermined participant predetermined Modell JW., Kambara TK., Perchuk BS., Laub MT. DIP original experiment: DIP-262264X PLoS biology 2014 IMEx A DNA damage-induced, SOS-independent checkpoint regulates cell division in Caulobacter crescentus. A DNA damage-induced, SOS-independent checkpoint regulates cell division in Caulobacter crescentus. A DNA damage-induced, SOS-independent checkpoint regulates cell division in Caulobacter crescentus. PLoS biology 2014 imex curation Modell JW., Kambara TK., Perchuk BS., Laub MT. Only protein-protein interactions ecolx Escherichia coli adenylate cyclase adenylate cyclase complementation bacterial two-hybrid bacterial two-hybrid adenylate cyclase predetermined predetermined participant predetermined Modell JW., Kambara TK., Perchuk BS., Laub MT. DIP original experiment: DIP-262263X PLoS biology 2014 IMEx A DNA damage-induced, SOS-independent checkpoint regulates cell division in Caulobacter crescentus. sida_cauvn Cell division inhibitor SidA sidA SOS-induced inhibitor of cell division A CCNA_02004 protein protein strain na1000 / cb15 Caulobacter crescentus MIRVARESFALVSVIGFVWMMCTVANLVA DIP protein B8GWS7 original sequence version: 23 ftsw_cauvn Probable peptidoglycan glycosyltransferase FtsW ftsW Cell division protein FtsW Cell wall polymerase Peptidoglycan polymerase CCNA_02635 protein protein strain na1000 / cb15 Caulobacter crescentus MASNATHAFARTDRTALGLWWWTTDRWLLGATALLVTLGMLLSFASSPAAAQRIGIDDQFHFALRMCFFATASSVLMLITSMLSPRDIRRAAFFIYLGAIAVMIALPFIGHNAKGATRWLQFAGFTLQPSEFMKPALIVLVSWMFAEGQKGEGVPGVSIAFLLYFIAVALLLIQPDVGQTVLITIAFGAAFWMAGVPISWIMGLGGVALAGLGSTYFLFDHVHARVQKFLSPDQADTHQITRAAEAIRAGGLFGRGPGEGVMKRHVPDLHTDFIYSVAAEEYGLIFSWSLIGLFAFVVVRGLYKAMKLNDPFEQVAAAGLFVLVGQQALINIAVNLNMIPTKGMTLPFISYGGSSMLAMGLTLGMALALLRKRPGAYGASGEFGFGRADA DIP protein B8H092 original sequence version: 32 a0a0h3cbr2_cauvn CCNA_03212 protein protein strain na1000 / cb15 Caulobacter crescentus MTDFAMTQPFAAPRRSARFVRPGRPGGLWGAVHYAGVLLVWLMLFVVDRPLALKVMAERRADSPIPRHWGW 10FEFC866AE888EE ftsn_cauvn Cell division protein FtsN ftsN CCNA_02086 protein protein strain na1000 / cb15 Caulobacter crescentus MSDPHRGAYTPPTDAPLSFDARQPVRGARPLPMTLIISAVVLVTLVVAVVMIYRDGVRGPNDAPQAVGTEVAQMKTPPAESSQPKDPASGLQIYHNEEPQPSATFAAPPETPLARPVAPTATTPVETASLPAAKPAAPAPTIESLATAAAAQKPAPKPVQVAQAAPKPVAAAPATTATAPKPAAVSTGPASVQIGALSSPALADKAWAEAVRLAPGLAAGKGKKVETVDKNGTTLYRTSVTGFATREAAKAFCEAIAASGKSCFVK DIP protein B8GX61 original sequence version: 32 dida-ftsn-1 5 9 unspecified role unspecified role prey prey B8GX61:p.Leu202Pro L202P mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain L P This feature has been corrected as a result of our quality control procedures. The original label was 'L202P'. Wed May 02 15:26:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu202pro' Tue Jun 30 17:02:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu202Pro' B8GX61:p.Phe252Leu F252L mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain F L This feature has been corrected as a result of our quality control procedures. The original label was 'F252L'. Wed May 02 20:17:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe252leu' Tue Jun 30 19:48:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe252Leu' ecolx Escherichia coli 8 unspecified role unspecified role bait bait ecolx Escherichia coli physical association physical association ftsw-ftsn-1 1 7 unspecified role unspecified role bait bait ecolx Escherichia coli 9 unspecified role unspecified role prey prey ecolx Escherichia coli physical association physical association ftsn-dida-1 4 9 unspecified role unspecified role bait bait ecolx Escherichia coli 8 unspecified role unspecified role prey prey ecolx Escherichia coli physical association physical association ftsw-sida-1 3 7 unspecified role unspecified role bait bait B8H092:p.Ala31Lys A31K mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain A K This feature has been corrected as a result of our quality control procedures. The original label was 'A31K'. Wed May 02 15:22:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala31lys' Tue Jun 30 18:29:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala31Lys' ecolx Escherichia coli 6 unspecified role unspecified role prey prey ecolx Escherichia coli physical association physical association ftsn-sida-1 2 6 unspecified role unspecified role prey prey ecolx Escherichia coli 9 unspecified role unspecified role bait bait ecolx Escherichia coli physical association physical association