DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu A conserved endoplasmic reticulum membrane protein complex (EMC) facilitates phospholipid transfer from the ER to mitochondria. A conserved endoplasmic reticulum membrane protein complex (EMC) facilitates phospholipid transfer from the ER to mitochondria. PLoS biology 2014 imex curation Lahiri S., Chao JT., Tavassoli S., Wong AK., Choudhary V., Young BP., Loewen CJ., Prinz WA. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Lahiri S., Chao JT., Tavassoli S., Wong AK., Choudhary V., Young BP., Loewen CJ., Prinz WA. DIP original experiment: DIP-262237X PLoS biology 2014 IMEx A conserved endoplasmic reticulum membrane protein complex (EMC) facilitates phospholipid transfer from the ER to mitochondria. A conserved endoplasmic reticulum membrane protein complex (EMC) facilitates phospholipid transfer from the ER to mitochondria. A conserved endoplasmic reticulum membrane protein complex (EMC) facilitates phospholipid transfer from the ER to mitochondria. PLoS biology 2014 imex curation Lahiri S., Chao JT., Tavassoli S., Wong AK., Choudhary V., Young BP., Loewen CJ., Prinz WA. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Lahiri S., Chao JT., Tavassoli S., Wong AK., Choudhary V., Young BP., Loewen CJ., Prinz WA. DIP original experiment: DIP-262253X PLoS biology 2014 IMEx A conserved endoplasmic reticulum membrane protein complex (EMC) facilitates phospholipid transfer from the ER to mitochondria. A conserved endoplasmic reticulum membrane protein complex (EMC) facilitates phospholipid transfer from the ER to mitochondria. A conserved endoplasmic reticulum membrane protein complex (EMC) facilitates phospholipid transfer from the ER to mitochondria. PLoS biology 2014 imex curation Lahiri S., Chao JT., Tavassoli S., Wong AK., Choudhary V., Young BP., Loewen CJ., Prinz WA. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Lahiri S., Chao JT., Tavassoli S., Wong AK., Choudhary V., Young BP., Loewen CJ., Prinz WA. DIP original experiment: DIP-262246X PLoS biology 2014 IMEx A conserved endoplasmic reticulum membrane protein complex (EMC) facilitates phospholipid transfer from the ER to mitochondria. A conserved endoplasmic reticulum membrane protein complex (EMC) facilitates phospholipid transfer from the ER to mitochondria. A conserved endoplasmic reticulum membrane protein complex (EMC) facilitates phospholipid transfer from the ER to mitochondria. PLoS biology 2014 imex curation Lahiri S., Chao JT., Tavassoli S., Wong AK., Choudhary V., Young BP., Loewen CJ., Prinz WA. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Lahiri S., Chao JT., Tavassoli S., Wong AK., Choudhary V., Young BP., Loewen CJ., Prinz WA. DIP original experiment: DIP-262238X PLoS biology 2014 IMEx A conserved endoplasmic reticulum membrane protein complex (EMC) facilitates phospholipid transfer from the ER to mitochondria. A conserved endoplasmic reticulum membrane protein complex (EMC) facilitates phospholipid transfer from the ER to mitochondria. A conserved endoplasmic reticulum membrane protein complex (EMC) facilitates phospholipid transfer from the ER to mitochondria. PLoS biology 2014 imex curation Lahiri S., Chao JT., Tavassoli S., Wong AK., Choudhary V., Young BP., Loewen CJ., Prinz WA. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Lahiri S., Chao JT., Tavassoli S., Wong AK., Choudhary V., Young BP., Loewen CJ., Prinz WA. DIP original experiment: DIP-262235X PLoS biology 2014 IMEx A conserved endoplasmic reticulum membrane protein complex (EMC) facilitates phospholipid transfer from the ER to mitochondria. A conserved endoplasmic reticulum membrane protein complex (EMC) facilitates phospholipid transfer from the ER to mitochondria. A conserved endoplasmic reticulum membrane protein complex (EMC) facilitates phospholipid transfer from the ER to mitochondria. PLoS biology 2014 imex curation Lahiri S., Chao JT., Tavassoli S., Wong AK., Choudhary V., Young BP., Loewen CJ., Prinz WA. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Lahiri S., Chao JT., Tavassoli S., Wong AK., Choudhary V., Young BP., Loewen CJ., Prinz WA. DIP original experiment: DIP-262245X PLoS biology 2014 IMEx A conserved endoplasmic reticulum membrane protein complex (EMC) facilitates phospholipid transfer from the ER to mitochondria. A conserved endoplasmic reticulum membrane protein complex (EMC) facilitates phospholipid transfer from the ER to mitochondria. A conserved endoplasmic reticulum membrane protein complex (EMC) facilitates phospholipid transfer from the ER to mitochondria. PLoS biology 2014 imex curation Lahiri S., Chao JT., Tavassoli S., Wong AK., Choudhary V., Young BP., Loewen CJ., Prinz WA. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Lahiri S., Chao JT., Tavassoli S., Wong AK., Choudhary V., Young BP., Loewen CJ., Prinz WA. DIP original experiment: DIP-262231X PLoS biology 2014 IMEx A conserved endoplasmic reticulum membrane protein complex (EMC) facilitates phospholipid transfer from the ER to mitochondria. A conserved endoplasmic reticulum membrane protein complex (EMC) facilitates phospholipid transfer from the ER to mitochondria. A conserved endoplasmic reticulum membrane protein complex (EMC) facilitates phospholipid transfer from the ER to mitochondria. PLoS biology 2014 imex curation Lahiri S., Chao JT., Tavassoli S., Wong AK., Choudhary V., Young BP., Loewen CJ., Prinz WA. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Lahiri S., Chao JT., Tavassoli S., Wong AK., Choudhary V., Young BP., Loewen CJ., Prinz WA. DIP original experiment: DIP-262242X PLoS biology 2014 IMEx A conserved endoplasmic reticulum membrane protein complex (EMC) facilitates phospholipid transfer from the ER to mitochondria. A conserved endoplasmic reticulum membrane protein complex (EMC) facilitates phospholipid transfer from the ER to mitochondria. A conserved endoplasmic reticulum membrane protein complex (EMC) facilitates phospholipid transfer from the ER to mitochondria. PLoS biology 2014 imex curation Lahiri S., Chao JT., Tavassoli S., Wong AK., Choudhary V., Young BP., Loewen CJ., Prinz WA. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Lahiri S., Chao JT., Tavassoli S., Wong AK., Choudhary V., Young BP., Loewen CJ., Prinz WA. DIP original experiment: DIP-262239X PLoS biology 2014 IMEx A conserved endoplasmic reticulum membrane protein complex (EMC) facilitates phospholipid transfer from the ER to mitochondria. A conserved endoplasmic reticulum membrane protein complex (EMC) facilitates phospholipid transfer from the ER to mitochondria. A conserved endoplasmic reticulum membrane protein complex (EMC) facilitates phospholipid transfer from the ER to mitochondria. PLoS biology 2014 imex curation Lahiri S., Chao JT., Tavassoli S., Wong AK., Choudhary V., Young BP., Loewen CJ., Prinz WA. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Lahiri S., Chao JT., Tavassoli S., Wong AK., Choudhary V., Young BP., Loewen CJ., Prinz WA. DIP original experiment: DIP-262236X PLoS biology 2014 IMEx A conserved endoplasmic reticulum membrane protein complex (EMC) facilitates phospholipid transfer from the ER to mitochondria. A conserved endoplasmic reticulum membrane protein complex (EMC) facilitates phospholipid transfer from the ER to mitochondria. A conserved endoplasmic reticulum membrane protein complex (EMC) facilitates phospholipid transfer from the ER to mitochondria. PLoS biology 2014 imex curation Lahiri S., Chao JT., Tavassoli S., Wong AK., Choudhary V., Young BP., Loewen CJ., Prinz WA. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Lahiri S., Chao JT., Tavassoli S., Wong AK., Choudhary V., Young BP., Loewen CJ., Prinz WA. DIP original experiment: DIP-262244X PLoS biology 2014 IMEx A conserved endoplasmic reticulum membrane protein complex (EMC) facilitates phospholipid transfer from the ER to mitochondria. A conserved endoplasmic reticulum membrane protein complex (EMC) facilitates phospholipid transfer from the ER to mitochondria. A conserved endoplasmic reticulum membrane protein complex (EMC) facilitates phospholipid transfer from the ER to mitochondria. PLoS biology 2014 imex curation Lahiri S., Chao JT., Tavassoli S., Wong AK., Choudhary V., Young BP., Loewen CJ., Prinz WA. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Lahiri S., Chao JT., Tavassoli S., Wong AK., Choudhary V., Young BP., Loewen CJ., Prinz WA. DIP original experiment: DIP-262249X PLoS biology 2014 IMEx A conserved endoplasmic reticulum membrane protein complex (EMC) facilitates phospholipid transfer from the ER to mitochondria. A conserved endoplasmic reticulum membrane protein complex (EMC) facilitates phospholipid transfer from the ER to mitochondria. A conserved endoplasmic reticulum membrane protein complex (EMC) facilitates phospholipid transfer from the ER to mitochondria. PLoS biology 2014 imex curation Lahiri S., Chao JT., Tavassoli S., Wong AK., Choudhary V., Young BP., Loewen CJ., Prinz WA. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Lahiri S., Chao JT., Tavassoli S., Wong AK., Choudhary V., Young BP., Loewen CJ., Prinz WA. DIP original experiment: DIP-262243X PLoS biology 2014 IMEx A conserved endoplasmic reticulum membrane protein complex (EMC) facilitates phospholipid transfer from the ER to mitochondria. A conserved endoplasmic reticulum membrane protein complex (EMC) facilitates phospholipid transfer from the ER to mitochondria. A conserved endoplasmic reticulum membrane protein complex (EMC) facilitates phospholipid transfer from the ER to mitochondria. PLoS biology 2014 imex curation Lahiri S., Chao JT., Tavassoli S., Wong AK., Choudhary V., Young BP., Loewen CJ., Prinz WA. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Lahiri S., Chao JT., Tavassoli S., Wong AK., Choudhary V., Young BP., Loewen CJ., Prinz WA. DIP original experiment: DIP-262247X PLoS biology 2014 IMEx A conserved endoplasmic reticulum membrane protein complex (EMC) facilitates phospholipid transfer from the ER to mitochondria. A conserved endoplasmic reticulum membrane protein complex (EMC) facilitates phospholipid transfer from the ER to mitochondria. A conserved endoplasmic reticulum membrane protein complex (EMC) facilitates phospholipid transfer from the ER to mitochondria. PLoS biology 2014 imex curation Lahiri S., Chao JT., Tavassoli S., Wong AK., Choudhary V., Young BP., Loewen CJ., Prinz WA. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Lahiri S., Chao JT., Tavassoli S., Wong AK., Choudhary V., Young BP., Loewen CJ., Prinz WA. DIP original experiment: DIP-262252X PLoS biology 2014 IMEx A conserved endoplasmic reticulum membrane protein complex (EMC) facilitates phospholipid transfer from the ER to mitochondria. A conserved endoplasmic reticulum membrane protein complex (EMC) facilitates phospholipid transfer from the ER to mitochondria. A conserved endoplasmic reticulum membrane protein complex (EMC) facilitates phospholipid transfer from the ER to mitochondria. PLoS biology 2014 imex curation Lahiri S., Chao JT., Tavassoli S., Wong AK., Choudhary V., Young BP., Loewen CJ., Prinz WA. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Lahiri S., Chao JT., Tavassoli S., Wong AK., Choudhary V., Young BP., Loewen CJ., Prinz WA. DIP original experiment: DIP-262234X PLoS biology 2014 IMEx A conserved endoplasmic reticulum membrane protein complex (EMC) facilitates phospholipid transfer from the ER to mitochondria. A conserved endoplasmic reticulum membrane protein complex (EMC) facilitates phospholipid transfer from the ER to mitochondria. A conserved endoplasmic reticulum membrane protein complex (EMC) facilitates phospholipid transfer from the ER to mitochondria. PLoS biology 2014 imex curation Lahiri S., Chao JT., Tavassoli S., Wong AK., Choudhary V., Young BP., Loewen CJ., Prinz WA. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Lahiri S., Chao JT., Tavassoli S., Wong AK., Choudhary V., Young BP., Loewen CJ., Prinz WA. DIP original experiment: DIP-262232X PLoS biology 2014 IMEx A conserved endoplasmic reticulum membrane protein complex (EMC) facilitates phospholipid transfer from the ER to mitochondria. A conserved endoplasmic reticulum membrane protein complex (EMC) facilitates phospholipid transfer from the ER to mitochondria. A conserved endoplasmic reticulum membrane protein complex (EMC) facilitates phospholipid transfer from the ER to mitochondria. PLoS biology 2014 imex curation Lahiri S., Chao JT., Tavassoli S., Wong AK., Choudhary V., Young BP., Loewen CJ., Prinz WA. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Lahiri S., Chao JT., Tavassoli S., Wong AK., Choudhary V., Young BP., Loewen CJ., Prinz WA. DIP original experiment: DIP-262240X PLoS biology 2014 IMEx A conserved endoplasmic reticulum membrane protein complex (EMC) facilitates phospholipid transfer from the ER to mitochondria. A conserved endoplasmic reticulum membrane protein complex (EMC) facilitates phospholipid transfer from the ER to mitochondria. A conserved endoplasmic reticulum membrane protein complex (EMC) facilitates phospholipid transfer from the ER to mitochondria. PLoS biology 2014 imex curation Lahiri S., Chao JT., Tavassoli S., Wong AK., Choudhary V., Young BP., Loewen CJ., Prinz WA. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Lahiri S., Chao JT., Tavassoli S., Wong AK., Choudhary V., Young BP., Loewen CJ., Prinz WA. DIP original experiment: DIP-262233X PLoS biology 2014 IMEx A conserved endoplasmic reticulum membrane protein complex (EMC) facilitates phospholipid transfer from the ER to mitochondria. A conserved endoplasmic reticulum membrane protein complex (EMC) facilitates phospholipid transfer from the ER to mitochondria. A conserved endoplasmic reticulum membrane protein complex (EMC) facilitates phospholipid transfer from the ER to mitochondria. PLoS biology 2014 imex curation Lahiri S., Chao JT., Tavassoli S., Wong AK., Choudhary V., Young BP., Loewen CJ., Prinz WA. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Lahiri S., Chao JT., Tavassoli S., Wong AK., Choudhary V., Young BP., Loewen CJ., Prinz WA. DIP original experiment: DIP-262241X PLoS biology 2014 IMEx A conserved endoplasmic reticulum membrane protein complex (EMC) facilitates phospholipid transfer from the ER to mitochondria. A conserved endoplasmic reticulum membrane protein complex (EMC) facilitates phospholipid transfer from the ER to mitochondria. A conserved endoplasmic reticulum membrane protein complex (EMC) facilitates phospholipid transfer from the ER to mitochondria. PLoS biology 2014 imex curation Lahiri S., Chao JT., Tavassoli S., Wong AK., Choudhary V., Young BP., Loewen CJ., Prinz WA. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Lahiri S., Chao JT., Tavassoli S., Wong AK., Choudhary V., Young BP., Loewen CJ., Prinz WA. DIP original experiment: DIP-262251X PLoS biology 2014 IMEx A conserved endoplasmic reticulum membrane protein complex (EMC) facilitates phospholipid transfer from the ER to mitochondria. A conserved endoplasmic reticulum membrane protein complex (EMC) facilitates phospholipid transfer from the ER to mitochondria. A conserved endoplasmic reticulum membrane protein complex (EMC) facilitates phospholipid transfer from the ER to mitochondria. PLoS biology 2014 imex curation Lahiri S., Chao JT., Tavassoli S., Wong AK., Choudhary V., Young BP., Loewen CJ., Prinz WA. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Lahiri S., Chao JT., Tavassoli S., Wong AK., Choudhary V., Young BP., Loewen CJ., Prinz WA. DIP original experiment: DIP-262248X PLoS biology 2014 IMEx A conserved endoplasmic reticulum membrane protein complex (EMC) facilitates phospholipid transfer from the ER to mitochondria. A conserved endoplasmic reticulum membrane protein complex (EMC) facilitates phospholipid transfer from the ER to mitochondria. A conserved endoplasmic reticulum membrane protein complex (EMC) facilitates phospholipid transfer from the ER to mitochondria. PLoS biology 2014 imex curation Lahiri S., Chao JT., Tavassoli S., Wong AK., Choudhary V., Young BP., Loewen CJ., Prinz WA. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Lahiri S., Chao JT., Tavassoli S., Wong AK., Choudhary V., Young BP., Loewen CJ., Prinz WA. DIP original experiment: DIP-262250X PLoS biology 2014 IMEx A conserved endoplasmic reticulum membrane protein complex (EMC) facilitates phospholipid transfer from the ER to mitochondria. tom5_yeast Mitochondrial import receptor subunit TOM5 YPR133W-A TOM5 MOM8A Translocase of outer membrane 5 kDa subunit protein protein yeast Saccharomyces cerevisiae Baker's yeast MFGLPQQEVSEEEKRAHQEQTEKTLKQAAYVAAFLWVSPMIWHLVKKQWK E1419ED5FEC45E14 E1419ED5FEC45E14 emc1_yeast ER membrane protein complex subunit 1 YCL315 YCL45C YCL045C EMC1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MKITCTDLVYVFILLFLNTSCVQAVFSDDAFITDWQLANLGPWEKVIPDSRDRNRVLILSNPTETSCLVSSFNVSSGQILFRNVLPFTIDEIQLDSNDHNAMVCVNSSSNHWQKYDLHDWFLLEEGVDNAPSTTILPQSSYLNDQVSIKNNELHILDEQSKLAEWKLELPQGFNKVEYFHREDPLALVLNVNDTQYMGFSANGTELIPVWQRDEWLTNVVDYAVLDVFDSRDVELNKDMKAELDSNSLWNAYWLRLTTNWNRLINLLKENQFSPGRVFTKLLALDAKDTTVSDLKFGFAKILIVLTHDGFIGGLDMVNKGQLIWKLDLEIDQGVKMFWTDKNHDELVVFSHDGHYLTIEVTKDQPIIKSRSPLSERKTVDSVIRLNEHDHQYLIKFEDKDHLLFKLNPGKNTDVPIVANNHSSSHIFVTEHDTNGIYGYIIENDTVKQTWKKAVNSKEKMVAYSKRETTNLNTLGITLGDKSVLYKYLYPNLAAYLIANEEHHTITFNLIDTITGEILITQEHKDSPDFRFPMDIVFGEYWVVYSYFSSEPVPEQKLVVVELYESLTPDERLSNSSDNFSYDPLTGHINKPQFQTKQFIFPEIIKTMSISKTTDDITTKAIVMELENGQITYIPKLLLNARGKPAEEMAKDKKKEFMATPYTPVIPINDNFIITHFRNLLPGSDSQLISIPTNLESTSIICDLGLDVFCTRITPSGQFDLMSPTFEKGKLLITIFVLLVITYFIRPSVSNKKLKSQWLIK 56F2B5A7186BDF7A 56F2B5A7186BDF7A emc5_yeast ER membrane protein complex subunit 5 EMC5 KRE27 Killer toxin-resistance protein 27 YIL027C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSFVSKLLYTVSALVLFHSGFSSYEFHHLLKLNSLNNAQGAISKLPKDIMYETYAGLILFVLAVFTSFEKLQYLPIESNDGKIISQGNYLKEIALNKATNVDNLIGSNPNGEIIFTPSFVDVHMKRKICREWASNTVKKEK 6DBEEEE7722203B0 6DBEEEE7722203B0 emc3_yeast ER membrane protein complex subunit 3 EMC3 AIM27 Altered inheritance rate of mitochondria protein 27 YKL207W protein protein yeast Saccharomyces cerevisiae Baker's yeast MLLDDQLKYWVLLPISIVMVLTGVLKQYIMTLITGSSANEAQPRVKLTEWQYLQWAQLLIGNGGNLSSDAFAAKKEFLVKDLTEERHLAKAKQQDGSQAGEVPNPFNDPSMSNAMMNMAKGNMASFIPQTIIMWWVNHFFAGFILMQLPFPLTAKFKEMLQTGIICQDLDVRWVSSISWYFISVLGLNPVYNLIGLNDQDMGIQAGIGGPQGPQGPPQSQVDKAMHAMANDLTIIQHETCLDNVEQRVLKQYM 499475DA44B93B3E 499475DA44B93B3E emc4_yeast ER membrane protein complex subunit 4 EMC4 YGL231C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSEQEPYEWAKHLLDTKYIEKYNIQNSNTLPSPPGFEGNSSKGNVTRKQQDATSQTTSLAQKNQITVLQVQKAWQIALQPAKSIPMNIFMSYMSGTSLQIIPIMTALMLLSGPIKAIFSTRSAFKPVLGNKATQSQVQTAMFMYIVFQGVLMYIGYRKLNSMGLIPNAKGDWLPWERIAHYNNGLQWFSD 062AE1EAB05360EE 062AE1EAB05360EE emc2_yeast ER membrane protein complex subunit 2 EMC2 J1875 YJR088C protein protein yeast Saccharomyces cerevisiae Baker's yeast MLKDLVREKLLTIMNTKAYTQFNPEQLLQLENEMKIYMKSGDSALTEGNYFFLMEMLFYVLVYRNQDVDAQVVYNTLRDRLGENSYKMVIMKATLLQINGNDKGAIEYLENLLNDDLEYETDFVTYVSIAKKLIAIKTTSKNLSQESVLKEVVALTDKFPLDAELWWYASEIYFEMGQFEKACYCLEQVLCITPFNYACFGRLSETLYYEALRSKKQTKTELLEKALKNALRSVELSELYLKGWALVNIISRELGRNKQNDLIKLSASKLKEISAKSNNKDKITAELILNKI 157A03E75FB9E72A 157A03E75FB9E72A emc6_yeast ER membrane protein complex subunit 6 L1321 YLL014W EMC6 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSNEEVFTQINATANVVDNKKRLLFVQDSSALVLGLVAGFLQIESVHGFIWFLILYNLINVIYIVWICQLQPGKFYQSPLHDIFFESFFREITGFVMAWTFGYALIG 36C316F18156823E 36C316F18156823E emc2-tom5-1 22 29 unspecified role unspecified role unspecified role unspecified role cVenus-tag cVenus-tag c-venus c-venus c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 24 unspecified role unspecified role unspecified role unspecified role nVenus-tag nVenus-tag n-venus n-venus n-term range n-terminal range n-term range n-term range n-terminal range n-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association emc1-tom5-1 7 24 unspecified role unspecified role prey prey TAP-tag TAP-tag tandem tag tandem tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 25 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association emc6-tom5-1 15 30 unspecified role unspecified role unspecified role unspecified role cVenus-tag cVenus-tag c-venus c-venus c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 24 unspecified role unspecified role unspecified role unspecified role nVenus-tag nVenus-tag n-venus n-venus n-term range n-terminal range n-term range n-term range n-terminal range n-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association emc1-emc5-1 5 26 unspecified role unspecified role unspecified role unspecified role nVenus-tag nVenus-tag n-venus n-venus c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 25 unspecified role unspecified role unspecified role unspecified role cVenus-tag cVenus-tag c-venus c-venus c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association emc2-emc5-1 9 26 unspecified role unspecified role unspecified role unspecified role nVenus-tag nVenus-tag n-venus n-venus c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 29 unspecified role unspecified role unspecified role unspecified role cVenus-tag cVenus-tag c-venus c-venus c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association emc3-emc6-1 13 30 unspecified role unspecified role unspecified role unspecified role nVenus-tag nVenus-tag n-venus n-venus c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 27 unspecified role unspecified role unspecified role unspecified role cVenus-tag cVenus-tag c-venus c-venus c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association emc1-tom5-2 14 24 unspecified role unspecified role unspecified role unspecified role nVenus-tag nVenus-tag n-venus n-venus n-term range n-terminal range n-term range n-term range n-terminal range n-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 25 unspecified role unspecified role unspecified role unspecified role cVenus-tag cVenus-tag c-venus c-venus c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association emc2-tom5-2 17 29 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 24 unspecified role unspecified role prey prey TAP-tag TAP-tag tandem tag tandem tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association emc5-tom5-1 21 26 unspecified role unspecified role unspecified role unspecified role cVenus-tag cVenus-tag c-venus c-venus c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 24 unspecified role unspecified role unspecified role unspecified role nVenus-tag nVenus-tag n-venus n-venus n-term range n-terminal range n-term range n-term range n-terminal range n-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association emc1-emc6-1 10 30 unspecified role unspecified role unspecified role unspecified role nVenus-tag nVenus-tag n-venus n-venus c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 25 unspecified role unspecified role unspecified role unspecified role cVenus-tag cVenus-tag c-venus c-venus c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association emc2-emc6-1 18 30 unspecified role unspecified role unspecified role unspecified role nVenus-tag nVenus-tag n-venus n-venus c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 29 unspecified role unspecified role unspecified role unspecified role cVenus-tag cVenus-tag c-venus c-venus c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association emc4-emc5-1 11 28 unspecified role unspecified role unspecified role unspecified role cVenus-tag cVenus-tag c-venus c-venus c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 26 unspecified role unspecified role unspecified role unspecified role nVenus-tag nVenus-tag n-venus n-venus c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association emc5-tom5-2 19 26 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 24 unspecified role unspecified role prey prey TAP-tag TAP-tag tandem tag tandem tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association emc4-tom5-1 23 24 unspecified role unspecified role unspecified role unspecified role nVenus-tag nVenus-tag n-venus n-venus n-term range n-terminal range n-term range n-term range n-terminal range n-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 28 unspecified role unspecified role unspecified role unspecified role cVenus-tag cVenus-tag c-venus c-venus c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association emc2-emc3-1 1 27 unspecified role unspecified role unspecified role unspecified role nVenus-tag nVenus-tag n-venus n-venus c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 29 unspecified role unspecified role unspecified role unspecified role cVenus-tag cVenus-tag c-venus c-venus c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association emc3-emc4-1 20 27 unspecified role unspecified role unspecified role unspecified role cVenus-tag cVenus-tag c-venus c-venus c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 28 unspecified role unspecified role unspecified role unspecified role nVenus-tag nVenus-tag n-venus n-venus c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association emc4-emc6-1 6 30 unspecified role unspecified role unspecified role unspecified role nVenus-tag nVenus-tag n-venus n-venus c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 28 unspecified role unspecified role unspecified role unspecified role cVenus-tag cVenus-tag c-venus c-venus c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association emc1-emc2-1 16 29 unspecified role unspecified role unspecified role unspecified role nVenus-tag nVenus-tag n-venus n-venus c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 25 unspecified role unspecified role unspecified role unspecified role cVenus-tag cVenus-tag c-venus c-venus c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association emc3-tom5-1 12 27 unspecified role unspecified role unspecified role unspecified role cVenus-tag cVenus-tag c-venus c-venus c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 24 unspecified role unspecified role unspecified role unspecified role nVenus-tag nVenus-tag n-venus n-venus n-term range n-terminal range n-term range n-term range n-terminal range n-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association emc2-emc4-1 4 28 unspecified role unspecified role unspecified role unspecified role nVenus-tag nVenus-tag n-venus n-venus c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 29 unspecified role unspecified role unspecified role unspecified role cVenus-tag cVenus-tag c-venus c-venus c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association emc2-tom5-3 2 29 unspecified role unspecified role unspecified role unspecified role cVenus-tag cVenus-tag c-venus c-venus c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 24 unspecified role unspecified role unspecified role unspecified role nVenus-tag nVenus-tag n-venus n-venus c-term range C-terminal range c-term range c-term range C-terminal range c-term range Region 1-29 Region 1-29 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association emc3-emc5-1 8 26 unspecified role unspecified role unspecified role unspecified role nVenus-tag nVenus-tag n-venus n-venus c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 27 unspecified role unspecified role unspecified role unspecified role cVenus-tag cVenus-tag c-venus c-venus c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association emc5-emc6-1 3 30 unspecified role unspecified role unspecified role unspecified role nVenus-tag nVenus-tag n-venus n-venus c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 26 unspecified role unspecified role unspecified role unspecified role cVenus-tag cVenus-tag c-venus c-venus c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association