DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Crystal structure of the Rab9A-RUTBC2 RBD complex reveals the molecular basis for the binding specificity of Rab9A with RUTBC2. Crystal structure of the Rab9A-RUTBC2 RBD complex reveals the molecular basis for the binding specificity of Rab9A with RUTBC2. Structure (London, England : 1993) 2014 imex curation Zhang Z., Wang S., Shen T., Chen J., Ding J. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Zhang Z., Wang S., Shen T., Chen J., Ding J. DIP original experiment: DIP-262289X Structure (London, England : 1993) 2014 IMEx Crystal structure of the Rab9A-RUTBC2 RBD complex reveals the molecular basis for the binding specificity of Rab9A with RUTBC2. Crystal structure of the Rab9A-RUTBC2 RBD complex reveals the molecular basis for the binding specificity of Rab9A with RUTBC2. Crystal structure of the Rab9A-RUTBC2 RBD complex reveals the molecular basis for the binding specificity of Rab9A with RUTBC2. Structure (London, England : 1993) 2014 imex curation Zhang Z., Wang S., Shen T., Chen J., Ding J. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Zhang Z., Wang S., Shen T., Chen J., Ding J. DIP original experiment: DIP-262280X Structure (London, England : 1993) 2014 IMEx Crystal structure of the Rab9A-RUTBC2 RBD complex reveals the molecular basis for the binding specificity of Rab9A with RUTBC2. Crystal structure of the Rab9A-RUTBC2 RBD complex reveals the molecular basis for the binding specificity of Rab9A with RUTBC2. Crystal structure of the Rab9A-RUTBC2 RBD complex reveals the molecular basis for the binding specificity of Rab9A with RUTBC2. Structure (London, England : 1993) 2014 imex curation Zhang Z., Wang S., Shen T., Chen J., Ding J. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Zhang Z., Wang S., Shen T., Chen J., Ding J. DIP original experiment: DIP-262285X Structure (London, England : 1993) 2014 IMEx Crystal structure of the Rab9A-RUTBC2 RBD complex reveals the molecular basis for the binding specificity of Rab9A with RUTBC2. Crystal structure of the Rab9A-RUTBC2 RBD complex reveals the molecular basis for the binding specificity of Rab9A with RUTBC2. Crystal structure of the Rab9A-RUTBC2 RBD complex reveals the molecular basis for the binding specificity of Rab9A with RUTBC2. Structure (London, England : 1993) 2014 imex curation Zhang Z., Wang S., Shen T., Chen J., Ding J. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Zhang Z., Wang S., Shen T., Chen J., Ding J. DIP original experiment: DIP-262290X Structure (London, England : 1993) 2014 IMEx Crystal structure of the Rab9A-RUTBC2 RBD complex reveals the molecular basis for the binding specificity of Rab9A with RUTBC2. Crystal structure of the Rab9A-RUTBC2 RBD complex reveals the molecular basis for the binding specificity of Rab9A with RUTBC2. Crystal structure of the Rab9A-RUTBC2 RBD complex reveals the molecular basis for the binding specificity of Rab9A with RUTBC2. Structure (London, England : 1993) 2014 imex curation Zhang Z., Wang S., Shen T., Chen J., Ding J. Only protein-protein interactions ecolx Escherichia coli dls dynamic light scattering dls predetermined predetermined participant predetermined Zhang Z., Wang S., Shen T., Chen J., Ding J. DIP original experiment: DIP-262286X Structure (London, England : 1993) 2014 IMEx Crystal structure of the Rab9A-RUTBC2 RBD complex reveals the molecular basis for the binding specificity of Rab9A with RUTBC2. Crystal structure of the Rab9A-RUTBC2 RBD complex reveals the molecular basis for the binding specificity of Rab9A with RUTBC2. Crystal structure of the Rab9A-RUTBC2 RBD complex reveals the molecular basis for the binding specificity of Rab9A with RUTBC2. Structure (London, England : 1993) 2014 imex curation Zhang Z., Wang S., Shen T., Chen J., Ding J. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Zhang Z., Wang S., Shen T., Chen J., Ding J. DIP original experiment: DIP-262292X Structure (London, England : 1993) 2014 IMEx Crystal structure of the Rab9A-RUTBC2 RBD complex reveals the molecular basis for the binding specificity of Rab9A with RUTBC2. Crystal structure of the Rab9A-RUTBC2 RBD complex reveals the molecular basis for the binding specificity of Rab9A with RUTBC2. Crystal structure of the Rab9A-RUTBC2 RBD complex reveals the molecular basis for the binding specificity of Rab9A with RUTBC2. Structure (London, England : 1993) 2014 imex curation Zhang Z., Wang S., Shen T., Chen J., Ding J. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Zhang Z., Wang S., Shen T., Chen J., Ding J. DIP original experiment: DIP-262291X Structure (London, England : 1993) 2014 IMEx Crystal structure of the Rab9A-RUTBC2 RBD complex reveals the molecular basis for the binding specificity of Rab9A with RUTBC2. Crystal structure of the Rab9A-RUTBC2 RBD complex reveals the molecular basis for the binding specificity of Rab9A with RUTBC2. Crystal structure of the Rab9A-RUTBC2 RBD complex reveals the molecular basis for the binding specificity of Rab9A with RUTBC2. Structure (London, England : 1993) 2014 imex curation Zhang Z., Wang S., Shen T., Chen J., Ding J. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Zhang Z., Wang S., Shen T., Chen J., Ding J. DIP original experiment: DIP-262283X Structure (London, England : 1993) 2014 IMEx Crystal structure of the Rab9A-RUTBC2 RBD complex reveals the molecular basis for the binding specificity of Rab9A with RUTBC2. Crystal structure of the Rab9A-RUTBC2 RBD complex reveals the molecular basis for the binding specificity of Rab9A with RUTBC2. Crystal structure of the Rab9A-RUTBC2 RBD complex reveals the molecular basis for the binding specificity of Rab9A with RUTBC2. Structure (London, England : 1993) 2014 imex curation Zhang Z., Wang S., Shen T., Chen J., Ding J. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Zhang Z., Wang S., Shen T., Chen J., Ding J. DIP original experiment: DIP-262279X Structure (London, England : 1993) 2014 IMEx Crystal structure of the Rab9A-RUTBC2 RBD complex reveals the molecular basis for the binding specificity of Rab9A with RUTBC2. Crystal structure of the Rab9A-RUTBC2 RBD complex reveals the molecular basis for the binding specificity of Rab9A with RUTBC2. Crystal structure of the Rab9A-RUTBC2 RBD complex reveals the molecular basis for the binding specificity of Rab9A with RUTBC2. Structure (London, England : 1993) 2014 imex curation Zhang Z., Wang S., Shen T., Chen J., Ding J. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Zhang Z., Wang S., Shen T., Chen J., Ding J. DIP original experiment: DIP-262293X Structure (London, England : 1993) 2014 IMEx Crystal structure of the Rab9A-RUTBC2 RBD complex reveals the molecular basis for the binding specificity of Rab9A with RUTBC2. Crystal structure of the Rab9A-RUTBC2 RBD complex reveals the molecular basis for the binding specificity of Rab9A with RUTBC2. Crystal structure of the Rab9A-RUTBC2 RBD complex reveals the molecular basis for the binding specificity of Rab9A with RUTBC2. Structure (London, England : 1993) 2014 imex curation Zhang Z., Wang S., Shen T., Chen J., Ding J. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Zhang Z., Wang S., Shen T., Chen J., Ding J. DIP original experiment: DIP-262294X Structure (London, England : 1993) 2014 IMEx Crystal structure of the Rab9A-RUTBC2 RBD complex reveals the molecular basis for the binding specificity of Rab9A with RUTBC2. Crystal structure of the Rab9A-RUTBC2 RBD complex reveals the molecular basis for the binding specificity of Rab9A with RUTBC2. Crystal structure of the Rab9A-RUTBC2 RBD complex reveals the molecular basis for the binding specificity of Rab9A with RUTBC2. Structure (London, England : 1993) 2014 imex curation Zhang Z., Wang S., Shen T., Chen J., Ding J. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Zhang Z., Wang S., Shen T., Chen J., Ding J. DIP original experiment: DIP-262295X Structure (London, England : 1993) 2014 IMEx Crystal structure of the Rab9A-RUTBC2 RBD complex reveals the molecular basis for the binding specificity of Rab9A with RUTBC2. Crystal structure of the Rab9A-RUTBC2 RBD complex reveals the molecular basis for the binding specificity of Rab9A with RUTBC2. Crystal structure of the Rab9A-RUTBC2 RBD complex reveals the molecular basis for the binding specificity of Rab9A with RUTBC2. Structure (London, England : 1993) 2014 imex curation Zhang Z., Wang S., Shen T., Chen J., Ding J. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Zhang Z., Wang S., Shen T., Chen J., Ding J. DIP original experiment: DIP-262282X Structure (London, England : 1993) 2014 IMEx Crystal structure of the Rab9A-RUTBC2 RBD complex reveals the molecular basis for the binding specificity of Rab9A with RUTBC2. Crystal structure of the Rab9A-RUTBC2 RBD complex reveals the molecular basis for the binding specificity of Rab9A with RUTBC2. Crystal structure of the Rab9A-RUTBC2 RBD complex reveals the molecular basis for the binding specificity of Rab9A with RUTBC2. Structure (London, England : 1993) 2014 imex curation Zhang Z., Wang S., Shen T., Chen J., Ding J. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Zhang Z., Wang S., Shen T., Chen J., Ding J. DIP original experiment: DIP-262288X Structure (London, England : 1993) 2014 IMEx Crystal structure of the Rab9A-RUTBC2 RBD complex reveals the molecular basis for the binding specificity of Rab9A with RUTBC2. Crystal structure of the Rab9A-RUTBC2 RBD complex reveals the molecular basis for the binding specificity of Rab9A with RUTBC2. Crystal structure of the Rab9A-RUTBC2 RBD complex reveals the molecular basis for the binding specificity of Rab9A with RUTBC2. Structure (London, England : 1993) 2014 imex curation Zhang Z., Wang S., Shen T., Chen J., Ding J. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Zhang Z., Wang S., Shen T., Chen J., Ding J. DIP original experiment: DIP-262281X Structure (London, England : 1993) 2014 IMEx Crystal structure of the Rab9A-RUTBC2 RBD complex reveals the molecular basis for the binding specificity of Rab9A with RUTBC2. Crystal structure of the Rab9A-RUTBC2 RBD complex reveals the molecular basis for the binding specificity of Rab9A with RUTBC2. Crystal structure of the Rab9A-RUTBC2 RBD complex reveals the molecular basis for the binding specificity of Rab9A with RUTBC2. Structure (London, England : 1993) 2014 imex curation Zhang Z., Wang S., Shen T., Chen J., Ding J. Only protein-protein interactions ecolx Escherichia coli dls dynamic light scattering dls predetermined predetermined participant predetermined Zhang Z., Wang S., Shen T., Chen J., Ding J. DIP original experiment: DIP-262284X Structure (London, England : 1993) 2014 IMEx Crystal structure of the Rab9A-RUTBC2 RBD complex reveals the molecular basis for the binding specificity of Rab9A with RUTBC2. Crystal structure of the Rab9A-RUTBC2 RBD complex reveals the molecular basis for the binding specificity of Rab9A with RUTBC2. Crystal structure of the Rab9A-RUTBC2 RBD complex reveals the molecular basis for the binding specificity of Rab9A with RUTBC2. Structure (London, England : 1993) 2014 imex curation Zhang Z., Wang S., Shen T., Chen J., Ding J. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Zhang Z., Wang S., Shen T., Chen J., Ding J. DIP original experiment: DIP-262287X Structure (London, England : 1993) 2014 IMEx Crystal structure of the Rab9A-RUTBC2 RBD complex reveals the molecular basis for the binding specificity of Rab9A with RUTBC2. rab9a_mouse Ras-related protein Rab-9A Rab9a Rab9 Sid99 Sid 99 protein protein mouse Mus musculus Mouse MAGKSSLFKIILLGDGGVGKSSLMNRYVTNKFDSQLFHTIGVEFLNKDLEVDGHFVTMQIWDTAGQERFRSLRTPFYRGSDCCLLTFSVDDSQSFQNLSNWKKEFIYYADVKEPESFPFVILGNKTDIKERQVSTEEAQAWCKDNGDYPYFETSAKDSTNVAAAFEEAVRRILATEDRSEHLIQTDTVNLHRKPKPNSSCC DIP protein Q9R0M6 original sequence version: 114 43F490EAA67D2C9A q8bpq7-1 Small G protein signaling modulator 1 Sgsm1 Rutbc2 RUN and TBC1 domain-containing protein 2 protein protein mouse Mus musculus Mouse MASVPAEAETRQRLLRTVKKEVKQIMEEAVTRKFVHEDSSHIISFCAAVEACVLHGLRRRAAGFLRSNKIAALFMKVGKGFPPAEELSRKVQELEQLIESARNQIQGLQENVRKLPKLPNLSPLAIKHLWIRTALFGRVLDKIVHYLVENSSKYYEKEALLMDPVDGPILASLLVGPCALEYTKMKTADHFWTDPSADELVQRHRIHSSHLRQDSPTKRPALCIQKRHSSGSMDDRPSISARDYVESLHQDSRATLLYGKNNVLVQPRDDMEAVPGYLSLHQTADVMTLKWTPNQLMNGSVGDLDYEKSVYWDYAVTIRLEEIVYLHCHQQVDSGGTVVLVSQDGIQRPPFRFPKGGHLLQFLSCLENGLLPHGQLDPPLWSQRGKGKVFPKLRKRSPQGSSESTSSDKEDDEATDYVFRIIYPGTQSEFVPQDLMDVSMNNLPPLWQPSPRKSSCSSCSQSGSADGGSTNGCNHERAPLKLLCDNMKYQILSRAFYGWLAYCRHLSTVRTHLSALVNHMIVSPDLPCDAGQGLTASIWEKYIQDSTTYPEQELLRLIYYGGVQPEIRRAVWPFLLGHYQFGMTEMERKEVDEQIHACYAQTMSEWLGCEAIVRQRERESHAAALAKCSSGASLDSHLHRMLHRDSTISNESSQSCSSGRQNLRLQSDSSSSTQVFESVDEVEQTEAEGRSEEKHPKIPNGNPANGTCSPDSGHPSSHNFSSGLSEHSEPSLSTEDSVLDAQRSLPAVFRPGDSSVEDGQSSEATTSRDEAPREELAVQDSLESDLLANESLEEFMSIPGSLDVALPEKDGAVMDGWPGEADKPSRADSEDNLSEEPEMESLFPALASLAVTSSANNEASPVSSSGVTYSPELLDLYTVNLHRIEKDVQRCDRSYWYFTAANLEKLRNIMCSYIWQHIEIGYVQGMCDLLAPLLVILDDEALAFSCFTELMKRMNQNFPHGGAMDTHFANMRSLIQILDSELFELMHQNGDYTHFYFCYRWFLLDFKRELVYDDVFSVWETIWAAKHVSSAHYVLFIALALVEVYRDIILENNMDFTDIIKFFNEMAERHNAKQILQLARDLVHKVQILIENK DIP protein Q8BPQ7-1 original sequence version: 80 rab9b_mouse Ras-related protein Rab-9B Rab9b protein protein mouse Mus musculus Mouse MSGKSLLLKVILLGDGGVGKSSLMNRYVTNKFDSQAFHTIGVEFLNRDLEVDGRFVTLQIWDTAGQERFKSLRTPFYRGADCCLLTFSVDDRQSFENLGNWQKEFIYYADVKDPDHFPFVVLGNKVDKEDRQVTTEEAQAWCMENGNYPYLETSAKDDTNVTVAFEEAVRQVLAVEEQLEHCMLGHTIDLNSGSKASSSCC DIP protein Q8BHH2 original sequence version: 94 1E28B18F8F8DDDFD q80u12-1 Small G protein signaling modulator 2 Sgsm2 Kiaa0397 Rutbc1 RUN and TBC1 domain-containing protein 1 protein protein mouse Mus musculus Mouse MGSAEDAVKEKLLWNVKKEVKQIMEEAVTRKFVHEDSSHIIALCGAVEACLLHQLRRRAAGFLRSDKMAALFTKVGKTCPVAEDICHKVQELQQQAEGRKPSGGSQEALRKQGSTGGKAPALSPQALKHIWVRTALMEKVLDRVVQYLAENCSKYYEKEALLADPVFGPILACLLVGPCALEYTKLKTADHYWTDPSADELVQRHRIRGPPNRQDSPAKRPALGIRKRHSSGSASEDRLAACAREYVESLHQNSRTRLLYGKNNVLVQPKEDMEAVPGYLSLHQSAENLTLKWTPNQLMNGTLGDSELEKSVYWDYALVVPFSQIVCIHCHQQKSGGTLVLVSQDGIQRPPLHFPQGGHLLSFLSCLENGLLPRGQLEPPLWTQQGKGKVFPKLRKRSSIRSIDVEELGVGRATDYVFRIIYPGHRHEHNAGDMIEMQGFGPSLTAWHLEPLCSQGSSCLSCSSSSSPYATPSHCSCIPDRLPLRLLCESMKRQIVSRAFYGWLAYCRHLSTVRTHLSALVHHNIIPPDRPPGASGGLTKDVWSKYQKDEKNYKELELLRQVYYGGVEHEIRKDVWPFLLGHYKFGMSKKEMEQVDTAVAARYQQVLAEWKACEVVVRQREREAHPATLTKFSSGSSIDSHVQRLVHRDSTISNDVFISVDDLEPSGPQDLEDSKPKREQEPGAGTPGIAAAEQQSVEFDSPDSGLPSSRNYSVASGIQSSLDEAQSVGFEDDGAGEDGSEGPATAAHTFPGPHDPGQETLAPASELEAGQELAAVCAAAYTIELLDTVALNLHRIDKDVQRCDRNYWYFTTSNLERLRDIMCSYVWEHLDMGYVQGMCDLLAPLLVILDNDQLAYSCFSHLMKRMGQNFPSGGAMDSHFANMRSLIQILDSELFELMHQNGDYTHFYFCYRWFLLDFKRELLYEDVFAVWEVIWAARRISSEHFVLFIALALVEAYREIIRDNNMDFTDIIKFFNERAERHDAQEILRIARDLVHKVQMLIDNK DIP protein Q80U12-1 original sequence version: 76 sgsm1-rab9a-1 17 19 unspecified role unspecified role bait bait Region 254-425 Region 254-425 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 18 unspecified role unspecified role prey prey Region 1-171 Region 1-171 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction rab9a-sgsm1-1 9 19 unspecified role unspecified role unspecified role unspecified role Region 254-425 Region 254-425 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 18 unspecified role unspecified role unspecified role unspecified role Region 1-199 Region 1-199 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction sgsm1-rab9b-1 4 20 unspecified role unspecified role prey prey Region 1-171 Region 1-171 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 19 unspecified role unspecified role bait bait Region 254-425 Region 254-425 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli direct interaction direct interaction rab9b-1 5 20 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction rab9a-sgsm1-2 13 19 unspecified role unspecified role prey prey Region 254-425 Region 254-425 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q8BPQ7-1:p.Leu256Ala L256A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L256A'. Wed May 02 18:36:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu256ala' Tue Jun 30 16:04:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu256Ala' Q8BPQ7-1:p.Lys260Ala K260A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain K A This feature has been corrected as a result of our quality control procedures. The original label was 'K260A'. Wed May 02 14:55:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys260ala' Tue Jun 30 19:00:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys260Ala' Q8BPQ7-1:p.Asn261Ala N261A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain N A This feature has been corrected as a result of our quality control procedures. The original label was 'N261A'. Wed May 02 19:26:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn261ala' Tue Jun 30 18:30:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn261Ala' Q8BPQ7-1:p.Tyr277Ala Y277A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Y A This feature has been corrected as a result of our quality control procedures. The original label was 'Y277A'. Wed May 02 15:27:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr277ala' Tue Jun 30 18:51:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr277Ala' Q8BPQ7-1:p.Asn294Ala N294A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain N A This feature has been corrected as a result of our quality control procedures. The original label was 'N294A'. Wed May 02 18:13:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn294ala' Tue Jun 30 17:40:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn294Ala' Q8BPQ7-1:p.Met297Ala M297A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain M A This feature has been corrected as a result of our quality control procedures. The original label was 'M297A'. Wed May 02 16:52:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met297ala' Tue Jun 30 18:46:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met297Ala' ecolx Escherichia coli 18 unspecified role unspecified role bait bait Region 1-199 Region 1-199 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction rab9a-sgsm1-3 10 19 unspecified role unspecified role unspecified role unspecified role Region 254-425 Region 254-425 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 18 unspecified role unspecified role unspecified role unspecified role Region 1-171 Region 1-171 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Q9R0M6:p.Ile40Ala I40A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain I A This feature has been corrected as a result of our quality control procedures. The original label was 'I40A'. Wed May 02 18:01:12 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile40ala' Tue Jun 30 19:01:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile40Ala' Q9R0M6:p.Gly41Ala G41A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain G A This feature has been corrected as a result of our quality control procedures. The original label was 'G41A'. Wed May 02 19:41:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly41ala' Tue Jun 30 19:00:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly41Ala' Q9R0M6:p.Gly41Asp G41D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain G D This feature has been corrected as a result of our quality control procedures. The original label was 'G41D'. Wed May 02 14:24:11 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly41asp' Tue Jun 30 17:01:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly41Asp' Q9R0M6:p.Val42Ala V42A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain V A This feature has been corrected as a result of our quality control procedures. The original label was 'V42A'. Wed May 02 15:16:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val42ala' Tue Jun 30 16:41:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val42Ala' Q9R0M6:p.Glu43Ala E43A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain E A This feature has been corrected as a result of our quality control procedures. The original label was 'E43A'. Wed May 02 20:03:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu43ala' Tue Jun 30 19:05:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu43Ala' Q9R0M6:p.Phe44Ala F44A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F44A'. Wed May 02 18:09:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe44ala' Tue Jun 30 15:39:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe44Ala' Q9R0M6:p.Trp61Ala W61A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain W A This feature has been corrected as a result of our quality control procedures. The original label was 'W61A'. Wed May 02 18:11:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp61ala' Tue Jun 30 19:26:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp61Ala' Q9R0M6:p.Phe76Ala F76A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F76A'. Wed May 02 18:41:11 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe76ala' Tue Jun 30 18:06:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe76Ala' ecolx Escherichia coli direct interaction direct interaction rab9a-sgsm1-4 2 19 unspecified role unspecified role unspecified role unspecified role Region 254-425 Region 254-425 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 18 unspecified role unspecified role unspecified role unspecified role Region 1-199 Region 1-199 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction sgsm2-rab9a-1 7 21 unspecified role unspecified role bait bait Region 242-424 Region 242-424 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 18 unspecified role unspecified role prey prey Region 1-171 Region 1-171 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction sgsm1-rab9b-2 14 20 unspecified role unspecified role prey prey Region 1-171 Region 1-171 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 19 unspecified role unspecified role bait bait Region 254-425 Region 254-425 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli direct interaction direct interaction sgsm2-rab9b-1 6 20 unspecified role unspecified role prey prey Region 1-171 Region 1-171 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 21 unspecified role unspecified role bait bait Region 242-424 Region 242-424 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli direct interaction direct interaction rab9a-sgsm1-5 15 19 unspecified role unspecified role prey prey Region 254-425 Region 254-425 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 18 unspecified role unspecified role bait bait Region 1-199 Region 1-199 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q9R0M6:p.Ile40Ala I40A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain I A This feature has been corrected as a result of our quality control procedures. The original label was 'I40A'. Wed May 02 18:48:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile40ala' Tue Jun 30 17:15:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile40Ala' Q9R0M6:p.Gly41Ala G41A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain G A This feature has been corrected as a result of our quality control procedures. The original label was 'G41A'. Wed May 02 19:18:20 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly41ala' Tue Jun 30 17:37:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly41Ala' Q9R0M6:p.Gly41Asp G41D mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain G D This feature has been corrected as a result of our quality control procedures. The original label was 'G41D'. Wed May 02 15:39:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly41asp' Tue Jun 30 19:22:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly41Asp' Q9R0M6:p.Val42Ala V42A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain V A This feature has been corrected as a result of our quality control procedures. The original label was 'V42A'. Wed May 02 17:17:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val42ala' Tue Jun 30 17:36:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val42Ala' Q9R0M6:p.Glu43Ala E43A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain E A This feature has been corrected as a result of our quality control procedures. The original label was 'E43A'. Wed May 02 17:16:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu43ala' Tue Jun 30 19:46:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu43Ala' Q9R0M6:p.Phe44Ala F44A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F44A'. Wed May 02 18:51:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe44ala' Tue Jun 30 15:47:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe44Ala' Q9R0M6:p.Trp61Ala W61A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain W A This feature has been corrected as a result of our quality control procedures. The original label was 'W61A'. Wed May 02 17:06:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp61ala' Tue Jun 30 18:29:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp61Ala' Q9R0M6:p.Phe69Ala F69A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F69A'. Wed May 02 17:00:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe69ala' Tue Jun 30 16:17:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe69Ala' Q9R0M6:p.Leu72Ala L72A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L72A'. Wed May 02 16:06:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu72ala' Tue Jun 30 17:00:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu72Ala' Q9R0M6:p.Phe76Ala F76A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F76A'. Wed May 02 15:41:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe76ala' Tue Jun 30 18:40:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe76Ala' ecolx Escherichia coli direct interaction direct interaction rab9a-1 8 18 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction rab9b-sgsm1-1 12 19 unspecified role unspecified role unspecified role unspecified role Region 254-425 Region 254-425 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 20 unspecified role unspecified role unspecified role unspecified role Region 1-171 Region 1-171 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction rab9a-sgsm1-6 11 19 unspecified role unspecified role unspecified role unspecified role Region 254-425 Region 254-425 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q8BPQ7-1:p.Leu256Ala L256A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L256A'. Wed May 02 19:42:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu256ala' Tue Jun 30 18:15:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu256Ala' Q8BPQ7-1:p.Lys260Ala K260A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain K A This feature has been corrected as a result of our quality control procedures. The original label was 'K260A'. Wed May 02 16:54:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys260ala' Tue Jun 30 18:30:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys260Ala' Q8BPQ7-1:p.Asn261Ala N261A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain N A This feature has been corrected as a result of our quality control procedures. The original label was 'N261A'. Wed May 02 17:11:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn261ala' Tue Jun 30 18:10:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn261Ala' Q8BPQ7-1:p.Tyr277Ala Y277A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Y A This feature has been corrected as a result of our quality control procedures. The original label was 'Y277A'. Wed May 02 18:25:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr277ala' Tue Jun 30 18:17:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr277Ala' Q8BPQ7-1:p.Asn294Ala N294A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain N A This feature has been corrected as a result of our quality control procedures. The original label was 'N294A'. Wed May 02 14:33:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn294ala' Tue Jun 30 20:07:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn294Ala' Q8BPQ7-1:p.Met297Ala M297A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain M A This feature has been corrected as a result of our quality control procedures. The original label was 'M297A'. Wed May 02 20:00:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met297ala' Tue Jun 30 17:07:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met297Ala' ecolx Escherichia coli 18 unspecified role unspecified role unspecified role unspecified role Region 1-199 Region 1-199 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction rab9a-2 16 18 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction sgsm1-rab9a-2 1 19 unspecified role unspecified role bait bait Region 254-425 Region 254-425 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 18 unspecified role unspecified role prey prey Region 1-171 Region 1-171 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction rab9b-2 3 20 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction