DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structural basis for the assembly of the Sxl-Unr translation regulatory complex. Structural basis for the assembly of the Sxl-Unr translation regulatory complex. Nature 2014 imex curation Hennig J., Militti C., Popowicz GM., Wang I., Sonntag M., Geerlof A., Gabel F., Gebauer F., Sattler M. Only protein-protein interactions in vitro In vitro emsa electrophoretic mobility shift assay Gel retardation assay band shift band shift Gel retardation assay emsa predetermined predetermined participant predetermined Hennig J., Militti C., Popowicz GM., Wang I., Sonntag M., Geerlof A., Gabel F., Gebauer F., Sattler M. DIP original experiment: DIP-262314X Nature 2014 IMEx Structural basis for the assembly of the Sxl-Unr translation regulatory complex. Structural basis for the assembly of the Sxl-Unr translation regulatory complex. Structural basis for the assembly of the Sxl-Unr translation regulatory complex. Nature 2014 imex curation Hennig J., Militti C., Popowicz GM., Wang I., Sonntag M., Geerlof A., Gabel F., Gebauer F., Sattler M. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Hennig J., Militti C., Popowicz GM., Wang I., Sonntag M., Geerlof A., Gabel F., Gebauer F., Sattler M. DIP original experiment: DIP-262319X Nature 2014 IMEx Structural basis for the assembly of the Sxl-Unr translation regulatory complex. Structural basis for the assembly of the Sxl-Unr translation regulatory complex. Structural basis for the assembly of the Sxl-Unr translation regulatory complex. Nature 2014 imex curation Hennig J., Militti C., Popowicz GM., Wang I., Sonntag M., Geerlof A., Gabel F., Gebauer F., Sattler M. Only protein-protein interactions in vitro In vitro saxs x ray scattering saxs predetermined predetermined participant predetermined Hennig J., Militti C., Popowicz GM., Wang I., Sonntag M., Geerlof A., Gabel F., Gebauer F., Sattler M. DIP original experiment: DIP-262317X Nature 2014 IMEx Structural basis for the assembly of the Sxl-Unr translation regulatory complex. Structural basis for the assembly of the Sxl-Unr translation regulatory complex. Structural basis for the assembly of the Sxl-Unr translation regulatory complex. Nature 2014 imex curation Hennig J., Militti C., Popowicz GM., Wang I., Sonntag M., Geerlof A., Gabel F., Gebauer F., Sattler M. Only protein-protein interactions in vitro In vitro sans small angle neutron scattering SANS SANS sans predetermined predetermined participant predetermined Hennig J., Militti C., Popowicz GM., Wang I., Sonntag M., Geerlof A., Gabel F., Gebauer F., Sattler M. DIP original experiment: DIP-262318X Nature 2014 IMEx Structural basis for the assembly of the Sxl-Unr translation regulatory complex. Structural basis for the assembly of the Sxl-Unr translation regulatory complex. Structural basis for the assembly of the Sxl-Unr translation regulatory complex. Nature 2014 imex curation Hennig J., Militti C., Popowicz GM., Wang I., Sonntag M., Geerlof A., Gabel F., Gebauer F., Sattler M. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Hennig J., Militti C., Popowicz GM., Wang I., Sonntag M., Geerlof A., Gabel F., Gebauer F., Sattler M. DIP original experiment: DIP-262312X Nature 2014 IMEx Structural basis for the assembly of the Sxl-Unr translation regulatory complex. Structural basis for the assembly of the Sxl-Unr translation regulatory complex. Structural basis for the assembly of the Sxl-Unr translation regulatory complex. Nature 2014 imex curation Hennig J., Militti C., Popowicz GM., Wang I., Sonntag M., Geerlof A., Gabel F., Gebauer F., Sattler M. Only protein-protein interactions in vitro In vitro sls static light scattering sls predetermined predetermined participant predetermined Hennig J., Militti C., Popowicz GM., Wang I., Sonntag M., Geerlof A., Gabel F., Gebauer F., Sattler M. DIP original experiment: DIP-262316X Nature 2014 IMEx Structural basis for the assembly of the Sxl-Unr translation regulatory complex. Structural basis for the assembly of the Sxl-Unr translation regulatory complex. Structural basis for the assembly of the Sxl-Unr translation regulatory complex. Nature 2014 imex curation Hennig J., Militti C., Popowicz GM., Wang I., Sonntag M., Geerlof A., Gabel F., Gebauer F., Sattler M. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Hennig J., Militti C., Popowicz GM., Wang I., Sonntag M., Geerlof A., Gabel F., Gebauer F., Sattler M. DIP original experiment: DIP-262315X Nature 2014 IMEx Structural basis for the assembly of the Sxl-Unr translation regulatory complex. Structural basis for the assembly of the Sxl-Unr translation regulatory complex. Structural basis for the assembly of the Sxl-Unr translation regulatory complex. Nature 2014 imex curation Hennig J., Militti C., Popowicz GM., Wang I., Sonntag M., Geerlof A., Gabel F., Gebauer F., Sattler M. Only protein-protein interactions in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Hennig J., Militti C., Popowicz GM., Wang I., Sonntag M., Geerlof A., Gabel F., Gebauer F., Sattler M. DIP original experiment: DIP-262313X Nature 2014 IMEx Structural basis for the assembly of the Sxl-Unr translation regulatory complex. p19339-1 Protein sex-lethal female-specific L T Sxl Sx1 CG43770 CF1 D protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MYGNNNPGSNNNNGGYPPYGYNNKSSGGRGFGMSHSLPSGMSRYAFSPQDTEFSFPSSSSRRGYNDFPGCGGSGGNGGSANNLGGGNMCHLPPMASNNSLNNLCGLSLGSGGSDDLMNDPRASNTNLIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSFGYAFVDFTSEMDSQRAIKVLNGITVRNKRLKVSYARPGGESIKDTNLYVTNLPRTITDDQLDTIFGKYGSIVQKNILRDKLTGRPRGVAFVRYNKREEAQEAISALNNVIPEGGSQPLSVRLAEEHGKAKAAHFMSQMGVVPANVPPPPPQPPAHMAAAFNMMHRGRSIKSQQRFQNSHPYFDAKKFI DIP protein P19339-1 original sequence version: 155 q9vsk3_drome Unr BcDNA:LD13080 CR32028 Dmel\CG7015 MRE30 UNR dUNR unr Dmel_CG7015 CG7015 dunr dUnr protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MNTQSKVYRTGEEIYDNLPCDSYFNMNAIRNLGIPTTFPTIGTFTLDSTTLGLQPQGQGPSPQQQQHQQQQQQQQQQHQQNMHHHQHQQQHMQQQQQQQQHQQQHQQQQHQQQQQHQQQQQQQQQHPTIGMFDANEVNDVIQNPPQIGVFQSNSVLTNGAGSGSSIFGSQSSNSSAAAADPSQTTRETGIIEKLLHSYGFIQCCERQARLFFHFSQFSGNIDHLKIGDPVEFEMTYDRRTGKPIASQVSKIAPEVVLSEERVTGTVTTELRTDSANNVLNSSETTGRISYENRGECFFLPYTKDDVEGNVNLRAGDKVSFQIATNQRGNLGACHIRLENPAQPVKYRGVVCSMKESFGFIERADVVKEIFFHFSEAEGNVELRPGDDVEFTIQTRSSASVPPQGREFACNITRLAPGSVIFEDVDSTVYKGQVLKSLDRNNPVRQNNDPLPGRIRYRALDYSEVEVPFGDKDQKGDFTLRHGDWVQFLLATDRRDQLQRATSIALLDETFKVSGEKREQGTIASLKEGFGFLRCVERQARLFFHFTEVLDTSREIDINDEVEFTVIQEPGLAYNNSRLQAIRIKHLPPNSVQFETLVASNIEGCVTREAPKSPIKSQDRVEGGVITYEHADVKKTIMYFLKDCEKPPRIGERVRFDIYMVKRNKECIAVNVQQVSLHQQQQQQQQQLHLNQSNAGANINQNDQLGGLSNGISSSSSNASLQNGYVMHGSPGGSTSSVGSNNPVHLDEFKMENNNHAGSDAGQVYRGFIAVMKENFGFIETLSHDEEVFFHFSNYMGNPNWLELGQEVEYTLARNGNTSVSGNCLPAENVRMLPKNSIPQPAVLETTHNGVVARPLRCINPDQQEYAGLIEILDELRTTVISQHEFGITSLVNKRDLLQKGDLVSFRIDESGRAACVNAVRQKKRATVDSIKGQFGFLNFEVEDGKKLFFHMSEVQGNTVALHPGDTVEFSVVTNQRNGKSSACNVLKINDRPDRLISRLKLNGDDTVPRLILIRAPKGPQGKGFSVLARHPRIPGNLVE DIP protein Q9VSK3 original sequence version: 114 8661A8693E3908FE sxl-unr-1 1 10 unspecified role unspecified role unspecified role unspecified role Region 185-252 Region 185-252 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role Region 122-301 Region 122-301 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association sxl-unr-2 5 10 unspecified role unspecified role unspecified role unspecified role Region 185-252 Region 185-252 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role Region 123-294 Region 123-294 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association sxl-unr-3 4 10 unspecified role unspecified role unspecified role unspecified role Region 185-252 Region 185-252 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role Region 123-294 Region 123-294 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association sxl-unr-4 6 10 unspecified role unspecified role unspecified role unspecified role Region 185-252 Region 185-252 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role Region 123-294 Region 123-294 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association sxl-unr-5 7 10 unspecified role unspecified role unspecified role unspecified role Region 185-252 Region 185-252 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role Region 123-294 Region 123-294 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association sxl-unr-6 8 10 unspecified role unspecified role unspecified role unspecified role Region 185-252 Region 185-252 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role Region 123-294 Region 123-294 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association sxl-unr-7 2 10 unspecified role unspecified role unspecified role unspecified role Region 185-252 Region 185-252 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role Region 123-294 Region 123-294 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association sxl-unr-8 3 10 unspecified role unspecified role unspecified role unspecified role Region 185-252 Region 185-252 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role Region 123-294 Region 123-294 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association