DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Reconstitution of the augmin complex provides insights into its architecture and function. Reconstitution of the augmin complex provides insights into its architecture and function. Nature cell biology 2014 imex curation Hsia KC., Wilson-Kubalek EM., Dottore A., Hao Q., Tsai KL., Forth S., Shimamoto Y., Milligan RA., Kapoor TM. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Hsia KC., Wilson-Kubalek EM., Dottore A., Hao Q., Tsai KL., Forth S., Shimamoto Y., Milligan RA., Kapoor TM. DIP original experiment: DIP-262398X Nature cell biology 2014 IMEx Reconstitution of the augmin complex provides insights into its architecture and function. Reconstitution of the augmin complex provides insights into its architecture and function. Reconstitution of the augmin complex provides insights into its architecture and function. Nature cell biology 2014 imex curation Hsia KC., Wilson-Kubalek EM., Dottore A., Hao Q., Tsai KL., Forth S., Shimamoto Y., Milligan RA., Kapoor TM. Only protein-protein interactions ecolx Escherichia coli tem transmission electron microscopy tem predetermined predetermined participant predetermined Hsia KC., Wilson-Kubalek EM., Dottore A., Hao Q., Tsai KL., Forth S., Shimamoto Y., Milligan RA., Kapoor TM. DIP original experiment: DIP-262404X Nature cell biology 2014 IMEx Reconstitution of the augmin complex provides insights into its architecture and function. Reconstitution of the augmin complex provides insights into its architecture and function. Reconstitution of the augmin complex provides insights into its architecture and function. Nature cell biology 2014 imex curation Hsia KC., Wilson-Kubalek EM., Dottore A., Hao Q., Tsai KL., Forth S., Shimamoto Y., Milligan RA., Kapoor TM. Only protein-protein interactions trini Trichoplusia ni (Cabbage looper) Cabbage looper molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Hsia KC., Wilson-Kubalek EM., Dottore A., Hao Q., Tsai KL., Forth S., Shimamoto Y., Milligan RA., Kapoor TM. DIP original experiment: DIP-262402X Nature cell biology 2014 IMEx Reconstitution of the augmin complex provides insights into its architecture and function. Reconstitution of the augmin complex provides insights into its architecture and function. Reconstitution of the augmin complex provides insights into its architecture and function. Nature cell biology 2014 imex curation Hsia KC., Wilson-Kubalek EM., Dottore A., Hao Q., Tsai KL., Forth S., Shimamoto Y., Milligan RA., Kapoor TM. Only protein-protein interactions ecolx Escherichia coli sls static light scattering sls predetermined predetermined participant predetermined Hsia KC., Wilson-Kubalek EM., Dottore A., Hao Q., Tsai KL., Forth S., Shimamoto Y., Milligan RA., Kapoor TM. DIP original experiment: DIP-262395X Nature cell biology 2014 IMEx Reconstitution of the augmin complex provides insights into its architecture and function. Reconstitution of the augmin complex provides insights into its architecture and function. Reconstitution of the augmin complex provides insights into its architecture and function. Nature cell biology 2014 imex curation Hsia KC., Wilson-Kubalek EM., Dottore A., Hao Q., Tsai KL., Forth S., Shimamoto Y., Milligan RA., Kapoor TM. Only protein-protein interactions ecolx Escherichia coli dls dynamic light scattering dls predetermined predetermined participant predetermined Hsia KC., Wilson-Kubalek EM., Dottore A., Hao Q., Tsai KL., Forth S., Shimamoto Y., Milligan RA., Kapoor TM. DIP original experiment: DIP-262407X Nature cell biology 2014 IMEx Reconstitution of the augmin complex provides insights into its architecture and function. Reconstitution of the augmin complex provides insights into its architecture and function. Reconstitution of the augmin complex provides insights into its architecture and function. Nature cell biology 2014 imex curation Hsia KC., Wilson-Kubalek EM., Dottore A., Hao Q., Tsai KL., Forth S., Shimamoto Y., Milligan RA., Kapoor TM. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Hsia KC., Wilson-Kubalek EM., Dottore A., Hao Q., Tsai KL., Forth S., Shimamoto Y., Milligan RA., Kapoor TM. DIP original experiment: DIP-262396X Nature cell biology 2014 IMEx Reconstitution of the augmin complex provides insights into its architecture and function. Reconstitution of the augmin complex provides insights into its architecture and function. Reconstitution of the augmin complex provides insights into its architecture and function. Nature cell biology 2014 imex curation Hsia KC., Wilson-Kubalek EM., Dottore A., Hao Q., Tsai KL., Forth S., Shimamoto Y., Milligan RA., Kapoor TM. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Hsia KC., Wilson-Kubalek EM., Dottore A., Hao Q., Tsai KL., Forth S., Shimamoto Y., Milligan RA., Kapoor TM. DIP original experiment: DIP-262401X Nature cell biology 2014 IMEx Reconstitution of the augmin complex provides insights into its architecture and function. Reconstitution of the augmin complex provides insights into its architecture and function. Reconstitution of the augmin complex provides insights into its architecture and function. Nature cell biology 2014 imex curation Hsia KC., Wilson-Kubalek EM., Dottore A., Hao Q., Tsai KL., Forth S., Shimamoto Y., Milligan RA., Kapoor TM. Only protein-protein interactions trini Trichoplusia ni (Cabbage looper) Cabbage looper tem transmission electron microscopy tem predetermined predetermined participant predetermined Hsia KC., Wilson-Kubalek EM., Dottore A., Hao Q., Tsai KL., Forth S., Shimamoto Y., Milligan RA., Kapoor TM. DIP original experiment: DIP-262403X Nature cell biology 2014 IMEx Reconstitution of the augmin complex provides insights into its architecture and function. Reconstitution of the augmin complex provides insights into its architecture and function. Reconstitution of the augmin complex provides insights into its architecture and function. Nature cell biology 2014 imex curation Hsia KC., Wilson-Kubalek EM., Dottore A., Hao Q., Tsai KL., Forth S., Shimamoto Y., Milligan RA., Kapoor TM. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Hsia KC., Wilson-Kubalek EM., Dottore A., Hao Q., Tsai KL., Forth S., Shimamoto Y., Milligan RA., Kapoor TM. DIP original experiment: DIP-262400X Nature cell biology 2014 IMEx Reconstitution of the augmin complex provides insights into its architecture and function. Reconstitution of the augmin complex provides insights into its architecture and function. Reconstitution of the augmin complex provides insights into its architecture and function. Nature cell biology 2014 imex curation Hsia KC., Wilson-Kubalek EM., Dottore A., Hao Q., Tsai KL., Forth S., Shimamoto Y., Milligan RA., Kapoor TM. Only protein-protein interactions ecolx Escherichia coli tem transmission electron microscopy tem predetermined predetermined participant predetermined Hsia KC., Wilson-Kubalek EM., Dottore A., Hao Q., Tsai KL., Forth S., Shimamoto Y., Milligan RA., Kapoor TM. DIP original experiment: DIP-262405X Nature cell biology 2014 IMEx Reconstitution of the augmin complex provides insights into its architecture and function. Reconstitution of the augmin complex provides insights into its architecture and function. Reconstitution of the augmin complex provides insights into its architecture and function. Nature cell biology 2014 imex curation Hsia KC., Wilson-Kubalek EM., Dottore A., Hao Q., Tsai KL., Forth S., Shimamoto Y., Milligan RA., Kapoor TM. Only protein-protein interactions ecolx Escherichia coli sls static light scattering sls predetermined predetermined participant predetermined Hsia KC., Wilson-Kubalek EM., Dottore A., Hao Q., Tsai KL., Forth S., Shimamoto Y., Milligan RA., Kapoor TM. DIP original experiment: DIP-262399X Nature cell biology 2014 IMEx Reconstitution of the augmin complex provides insights into its architecture and function. Reconstitution of the augmin complex provides insights into its architecture and function. Reconstitution of the augmin complex provides insights into its architecture and function. Nature cell biology 2014 imex curation Hsia KC., Wilson-Kubalek EM., Dottore A., Hao Q., Tsai KL., Forth S., Shimamoto Y., Milligan RA., Kapoor TM. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Hsia KC., Wilson-Kubalek EM., Dottore A., Hao Q., Tsai KL., Forth S., Shimamoto Y., Milligan RA., Kapoor TM. DIP original experiment: DIP-262394X Nature cell biology 2014 IMEx Reconstitution of the augmin complex provides insights into its architecture and function. Reconstitution of the augmin complex provides insights into its architecture and function. Reconstitution of the augmin complex provides insights into its architecture and function. Nature cell biology 2014 imex curation Hsia KC., Wilson-Kubalek EM., Dottore A., Hao Q., Tsai KL., Forth S., Shimamoto Y., Milligan RA., Kapoor TM. Only protein-protein interactions ecolx Escherichia coli dls dynamic light scattering dls predetermined predetermined participant predetermined Hsia KC., Wilson-Kubalek EM., Dottore A., Hao Q., Tsai KL., Forth S., Shimamoto Y., Milligan RA., Kapoor TM. DIP original experiment: DIP-262406X Nature cell biology 2014 IMEx Reconstitution of the augmin complex provides insights into its architecture and function. Reconstitution of the augmin complex provides insights into its architecture and function. Reconstitution of the augmin complex provides insights into its architecture and function. Nature cell biology 2014 imex curation Hsia KC., Wilson-Kubalek EM., Dottore A., Hao Q., Tsai KL., Forth S., Shimamoto Y., Milligan RA., Kapoor TM. Only protein-protein interactions ecolx Escherichia coli sls static light scattering sls predetermined predetermined participant predetermined Hsia KC., Wilson-Kubalek EM., Dottore A., Hao Q., Tsai KL., Forth S., Shimamoto Y., Milligan RA., Kapoor TM. DIP original experiment: DIP-262397X Nature cell biology 2014 IMEx Reconstitution of the augmin complex provides insights into its architecture and function. Reconstitution of the augmin complex provides insights into its architecture and function. Reconstitution of the augmin complex provides insights into its architecture and function. Nature cell biology 2014 imex curation Hsia KC., Wilson-Kubalek EM., Dottore A., Hao Q., Tsai KL., Forth S., Shimamoto Y., Milligan RA., Kapoor TM. Only protein-protein interactions ecolx Escherichia coli dls dynamic light scattering dls predetermined predetermined participant predetermined Hsia KC., Wilson-Kubalek EM., Dottore A., Hao Q., Tsai KL., Forth S., Shimamoto Y., Milligan RA., Kapoor TM. DIP original experiment: DIP-262408X Nature cell biology 2014 IMEx Reconstitution of the augmin complex provides insights into its architecture and function. haus1_human HAUS augmin-like complex subunit 1 HAUS1 CCDC5 HEIC Coiled-coil domain-containing protein 5 Enhancer of invasion-cluster protein protein human Homo sapiens Human MEPQEERETQVAAWLKKIFGDHPIPQYEVNPRTTEILHHLSERNRVRDRDVYLVIEDLKQKASEYESEAKYLQDLLMESVNFSPANLSSTGSRYLNALVDSAVALETKDTSLASFIPAVNDLTSDLFRTKSKSEEIKIELEKLEKNLTATLVLEKCLQEDVKKAELHLSTERAKVDNRRQNMDFLKAKSEEFRFGIKAAEEQLSARGMDASLSHQSLVALSEKLARLKQQTIPLKKKLESYLDLMPNPSLAQVKIEEAKRELDSIEAELTRRVDMMEL DIP protein Q96CS2 original sequence version: 69 DIP protein Q96CS2-1 original sequence version: 108 06F6A1B9FCF0698A haus7_human HAUS augmin-like complex subunit 7 HAUS7 26S proteasome-associated UCH37-interacting protein 1 X-linked protein STS1769 UIP1 UCHL5IP UCHL5-interacting protein protein protein human Homo sapiens Human MGGARLGARNMAGQDAGCGRGGDDYSEDEGDSSVSRAAVEVFGKLKDLNCPFLEGLYITEPKTIQELLCSPSEYRLEILEWMCTRVWPSLQDRFSSLKGVPTEVKIQEMTKLGHELMLCAPDDQELLKGCACAQKQLHFMDQLLDTIRSLTIGCSSCSSLMEHFEDTREKNEALLGELFSSPHLQMLLNPECDPWPLDMQPLLNKQSDDWQWASASAKSEEEEKLAELARQLQESAAKLHALRTEYFAQHEQGAAAGAADISTLDQKLRLVTSDFHQLILAFLQVYDDELGECCQRPGPDLHPCGPIIQATHQNLTSYSQLLQVVMAVADTSAKAVETVKKQQGEQICWGGSSSVMSLATKMNELMEK DIP protein Q99871 original sequence version: 61 DIP protein Q99871-1 original sequence version: 113 15E9A47D741DB26B haus4_human HAUS augmin-like complex subunit 4 HAUS4 C14orf94 protein protein human Homo sapiens Human MASGDFCSPGEGMEILQQVCSKQLPPCNLSKEDLLQNPYFSKLLLNLSQHVDESGLSLTLAKEQAQAWKEVRLHKTTWLRSEILHRVIQELLVDYYVKIQDTNVTSEDKKFHETLEQRLLVTELMRLLGPSQEREIPPLLGLEKADLLELMPLSEDFVWMRARLQQEVEEQLKKKCFTLLCYYDPNSDADSETVKAAKVWKLAEVLVGEQQQCQDAKSQQKEQMLLLEKKSAAYSQVLLRCLTLLQRLLQEHRLKTQSELDRINAQYLEVKCGAMILKLRMEELKILSDTYTVEKVEVHRLIRDRLEGAIHLQEQDMENSRQVLNSYEVLGEEFDRLVKEYTVLKQATENKRWALQEFSKVYR DIP protein Q9H6D7 original sequence version: 68 DIP protein Q9H6D7-1 original sequence version: 103 AAAFA1FFC25189C0 haus6_human HAUS augmin-like complex subunit 6 HAUS6 DGT6 FAM29A KIAA1574 protein protein human Homo sapiens Human MSSASVTAFEKEHLWMYLQALGFEPGPATIACGKIVSHTHLGVNMFDKLNRDAFHIISYFLFQVLDQSLTKEVFKFCWPPFDQKSDTEFRKHCCEWIKRISGECGSSFPQVVGSLFLSPGGPKFIHLMYHFARFVAMKYIKSNSKNSSHHFVETFNIKPQDLHKCIARCHFARSRFLQILQRQDCVTQKYQENAQLSVKQVRNLRSECIGLENQIKKMEPYDDHSNMEEKIQKVRSLWASVNETLMFLEKEREVVSSVLSLVNQYALDGTNVAINIPRLLLDKIEKQMFQLHIGNVYEAGKLNLLTVIQLLNEVLKVMKYERCQADQARLTVDLHYLEKETKFQKERLSDLKHMRYRIKDDLTTIRHSVVEKQGEWHKKWKEFLGLSPFSLIKGWTPSVDLLPPMSPLSFDPASEEVYAKSILCQYPASLPDAHKQHNQENGCRGDSDTLGALHDLANSPASFLSQSVSSSDRNSVTVLEKDTKMGTPKEKNEAISKKIPEFEVENSPLSDVAKNTESSAFGGSLPAKKSDPFQKEQDHLVEEVARAVLSDSPQLSEGKEIKLEELIDSLGSNPFLTRNQIPRTPENLITEIRSSWRKAIEMEENRTKEPIQMDAEHREVLPESLPVLHNQREFSMADFLLETTVSDFGQSHLTEEKVISDCECVPQKHVLTSHIDEPPTQNQSDLLNKKVICKQDLECLAFTKLSETSRMETFSPAVGNRIDVMGGSEEEFMKILDHLEVSCNKPSTNKTMLWNSFQISSGISSKSFKDNDFGILHETLPEEVGHLSFNSSSSSEANFKLEPNSPMHGGTLLEDVVGGRQTTPESDFNLQALRSRYEALKKSLSKKREESYLSNSQTPERHKPELSPTPQNVQTDDTLNFLDTCDLHTEHIKPSLRTSIGERKRSLSPLIKFSPVEQRLRTTIACSLGELPNLKEEDILNKSLDAKEPPSDLTR DIP protein Q7Z4H7 original sequence version: 60 DIP protein Q7Z4H7-1 original sequence version: 95 8EA52C24BA818C00 haus2_human HAUS augmin-like complex subunit 2 HAUS2 C15orf25 CEP27 Centrosomal protein of 27 kDa protein protein human Homo sapiens Human MAAANPWDPASAPNGAGLVLGHFIASGMVNQEMLNMSKKTVSCFVNFTRLQQITNIQAEIYQKNLEIELLKLEKDTADVVHPFFLAQKCHTLQSMNNHLEAVLKEKRSLRQRLLKPMCQENLPIEAVYHRYMVHLLELAVTFIERLETHLETIRNIPHLAANLKKMNQALAKMDILVTETEELAENILKWRKQQNEVSSCIPKILAEESYLYKHDIIMPPLPFTSKVHVQTINAK DIP protein Q9NVX0 original sequence version: 62 DIP protein Q9NVX0-1 original sequence version: 100 E1475D00313FCA7F haus3_human HAUS augmin-like complex subunit 3 HAUS3 C4orf15 protein protein human Homo sapiens Human MSCGNEFVETLKKIGYPKADNLNGEDFDWLFEGVEDESFLKWFCGNVNEQNVLSERELEAFSILQKSGKPILEGAALDEALKTCKTSDLKTPRLDDKELEKLEDEVQTLLKLKNLKIQRRNKCQLMASVTSHKSLRLNAKEEEATKKLKQSQGILNAMITKISNELQALTDEVTQLMMFFRHSNLGQGTNPLVFLSQFSLEKYLSQEEQSTAALTLYTKKQFFQGIHEVVESSNEDNFQLLDIQTPSICDNQEILEERRLEMARLQLAYICAQHQLIHLKASNSSMKSSIKWAEESLHSLTSKAVDKENLDAKISSLTSEIMKLEKEVTQIKDRSLPAVVRENAQLLNMPVVKGDFDLQIAKQDYYTARQELVLNQLIKQKASFELLQLSYEIELRKHRDIYRQLENLVQELSQSNMMLYKQLEMLTDPSVSQQINPRNTIDTKDYSTHRLYQVLEGENKKKELFLTHGNLEEVAEKLKQNISLVQDQLAVSAQEHSFFLSKRNKDVDMLCDTLYQGGNQLLLSDQELTEQFHKVESQLNKLNHLLTDILADVKTKRKTLANNKLHQMEREFYVYFLKDEDYLKDIVENLETQSKIKAVSLED DIP protein Q68CZ6 original sequence version: 46 DIP protein Q68CZ6 original sequence version: 81 C65B80CC58F326E9 haus5_human HAUS augmin-like complex subunit 5 HAUS5 KIAA0841 protein protein human Homo sapiens Human MELAQEARELGCWAVEEMGVPVAARAPESTLRRLCLGQGADIWAYILQHVHSQRTVKKIRGNLLWYGHQDSPQVRRKLELEAAVTRLRAEIQELDQSLELMERDTEAQDTAMEQARQHTQDTQRRALLLRAQAGAMRRQQHTLRDPMQRLQNQLRRLQDMERKAKVDVTFGSLTSAALGLEPVVLRDVRTACTLRAQFLQNLLLPQAKRGSLPTPHDDHFGTSYQQWLSSVETLLTNHPPGHVLAALEHLAAEREAEIRSLCSGDGLGDTEISRPQAPDQSDSSQTLPSMVHLIQEGWRTVGVLVSQRSTLLKERQVLTQRLQGLVEEVERRVLGSSERQVLILGLRRCCLWTELKALHDQSQELQDAAGHRQLLLRELQAKQQRILHWRQLVEETQEQVRLLIKGNSASKTRLCRSPGEVLALVQRKVVPTFEAVAPQSRELLRCLEEEVRHLPHILLGTLLRHRPGELKPLPTVLPSIHQLHPASPRGSSFIALSHKLGLPPGKASELLLPAAASLRQDLLLLQDQRSLWCWDLLHMKTSLPPGLPTQELLQIQASQEKQQKENLGQALKRLEKLLKQALERIPELQGIVGDWWEQPGQAALSEELCQGLSLPQWRLRWVQAQGALQKLCS DIP protein O94927 original sequence version: 64 DIP protein O94927-1 original sequence version: 102 23D8746F2A81ABCB haus8_human HAUS augmin-like complex subunit 8 HICE1 HEC1/NDC80-interacting centrosome-associated protein 1 Sarcoma antigen NY-SAR-48 HAUS8 protein protein human Homo sapiens Human MADSSGRGAGKPATGPTNSSSAKKKDKRVQGGRVIESRYLQYEKKTTQKAPAGDGSQTRGKMSEGGRKSSLLQKSKADSSGVGKGDLQSTLLEGHGTAPPDLDLSAINDKSIVKKTPQLAKTISKKPESTSFSAPRKKSPDLSEAMEMMESQTLLLTLLSVKMENNLAEFERRAEKNLLIMCKEKEKLQKKAHELKRRLLLSQRKRELADVLDAQIEMLSPFEAVATRFKEQYRTFATALDTTRHELPVRSIHLEGDGQQLLDALQHELVTTQRLLGELDVGDSEENVQVLDLLSELKDVTAKKDLELRRSFAQVLELSAEASKEAALANQEVWEETQGMAPPSRWYFNQDSACRESGGAPKNTPLSEDDNPGASSAPAQATFISPSEDFSSSSQAEVPPSLSRSGRDLS DIP protein Q9BT25 original sequence version: 50 DIP protein Q9BT25-1 original sequence version: 85 05D7B175523E5DA5 haus6-haus8-2 12 19 unspecified role unspecified role unspecified role unspecified role Region 1-432 Region 1-432 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 23 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction haus1-haus2-2 8 22 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper 21 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper 16 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper 18 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper 17 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper 20 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper 19 unspecified role unspecified role unspecified role unspecified role Region 1-432 Region 1-432 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper 23 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper physical association physical association haus1-haus4-3 1 16 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 18 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 19 unspecified role unspecified role unspecified role unspecified role Region 1-432 Region 1-432 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 23 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association haus2-haus6-3 13 17 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 20 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 19 unspecified role unspecified role unspecified role unspecified role Region 1-432 Region 1-432 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 23 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association haus6-haus8-3 4 19 unspecified role unspecified role unspecified role unspecified role Region 1-432 Region 1-432 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 23 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction haus1-haus4-4 10 16 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 18 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 19 unspecified role unspecified role unspecified role unspecified role Region 1-432 Region 1-432 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 23 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association haus1-haus4-5 7 16 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 18 unspecified role unspecified role unspecified role unspecified role Region 1-188 Region 1-188 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction haus6-haus8-4 15 19 unspecified role unspecified role unspecified role unspecified role Region 1-432 Region 1-432 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 23 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction haus2-haus6-4 6 17 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 20 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 19 unspecified role unspecified role unspecified role unspecified role Region 1-432 Region 1-432 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 23 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association haus1-haus4-6 5 16 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 18 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 19 unspecified role unspecified role unspecified role unspecified role Region 1-432 Region 1-432 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 23 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association haus1-haus4-7 11 16 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 18 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 19 unspecified role unspecified role unspecified role unspecified role Region 1-432 Region 1-432 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 23 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association haus1-haus2-3 3 22 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper 21 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper 16 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper 18 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper 17 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper 20 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper 19 unspecified role unspecified role unspecified role unspecified role Region 1-432 Region 1-432 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper 23 unspecified role unspecified role unspecified role unspecified role Region 141-410 Region 141-410 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper physical association physical association haus1-haus2-4 9 16 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 18 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 17 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 20 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 19 unspecified role unspecified role unspecified role unspecified role Region 1-432 Region 1-432 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 23 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association haus2-haus6-5 14 17 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 20 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 19 unspecified role unspecified role unspecified role unspecified role Region 1-432 Region 1-432 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 23 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association haus2-haus6-6 2 17 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 20 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 19 unspecified role unspecified role unspecified role unspecified role Region 1-432 Region 1-432 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 23 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association