UniProt UniProt http://www.uniprot.org SLURP-1 modulates corneal homeostasis by serving as a soluble scavenger of urokinase-type plasminogen activator. SLURP-1 modulates corneal homeostasis by serving as a soluble scavenger of urokinase-type plasminogen activator. Investigative ophthalmology & visual science 2014 imex curation Swamynathan S., Swamynathan SK. swamynathansk@upmc.edu 8-Jun-2017: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa western blot western blot Immuno blot Immuno blot Swamynathan S., Swamynathan SK. swamynathansk@upmc.edu Accepted 2017-MAY-17 AT 14:33 BST AT 14:33 BST by MGT Investigative ophthalmology & visual science 2014 imex curation SLURP-1 modulates corneal homeostasis by serving as a soluble scavenger of urokinase-type plasminogen activator. SLURP-1 modulates corneal homeostasis by serving as a soluble scavenger of urokinase-type plasminogen activator. Investigative ophthalmology & visual science 2014 imex curation Swamynathan S., Swamynathan SK. swamynathansk@upmc.edu 8-Jun-2017: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting western blot western blot Immuno blot Immuno blot Swamynathan S., Swamynathan SK. swamynathansk@upmc.edu Accepted 2017-MAY-17 AT 14:33 BST AT 14:33 BST by MGT Investigative ophthalmology & visual science 2014 imex curation SLURP-1 modulates corneal homeostasis by serving as a soluble scavenger of urokinase-type plasminogen activator. SLURP-1 modulates corneal homeostasis by serving as a soluble scavenger of urokinase-type plasminogen activator. Investigative ophthalmology & visual science 2014 imex curation Swamynathan S., Swamynathan SK. swamynathansk@upmc.edu 8-Jun-2017: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Swamynathan S., Swamynathan SK. swamynathansk@upmc.edu Accepted 2017-MAY-17 AT 14:33 BST AT 14:33 BST by MGT Investigative ophthalmology & visual science 2014 imex curation slur1_mouse Secreted Ly-6/uPAR-related protein 1 Ars Slurp1 ARS component B protein protein mouse Mus musculus Mouse MTLRWAMWLLLLAAWSMGYGEAFRCYTCEQPTAINSCKNIAQCKMEDTACKTVLETVEAAFPFNHSPMVTRSCSSSCLATDPDGIGVAHPVFCCFRDLCNSGFPGFVAGL AAB69CF6C5FE5BFC slur1_human Secreted Ly-6/uPAR-related protein 1 ARS ARS component B ARS(component B)-81/S Anti-neoplastic urinary protein SLURP1 protein protein human Homo sapiens Human MASRWAVQLLLVAAWSMGCGEALKCYTCKEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVTRSCSSSCVATDPDSIGAAHLIFCCFRDLCNSEL 07AAF6BCA8031282 urok_mouse Urokinase-type plasminogen activator Plau protein protein mouse Mus musculus Mouse MKVWLASLFLCALVVKNSEGGSVLGAPDESNCGCQNGGVCVSYKYFSRIRRCSCPRKFQGEHCEIDASKTCYHGNGDSYRGKANTDTKGRPCLAWNAPAVLQKPYNAHRPDAISLGLGKHNYCRNPDNQKRPWCYVQIGLRQFVQECMVHDCSLSKKPSSSVDQQGFQCGQKALRPRFKIVGGEFTEVENQPWFAAIYQKNKGGSPPSFKCGGSLISPCWVASAAHCFIQLPKKENYVVYLGQSKESSYNPGEMKFEVEQLILHEYYREDSLAYHNDIALLKIRTSTGQCAQPSRSIQTICLPPRFTDAPFGSDCEITGFGKESESDYLYPKNLKMSVVKLVSHEQCMQPHYYGSEINYKMLCAADPEWKTDSCKGDSGGPLICNIEGRPTLSGIVSWGRGCAEKNKPGVYTRVSHFLDWIQSHIGEEKGLAF mint Specifically cleave the zymogen plasminogen to form the active enzyme plasmin A99C35F6250443F9 urok_human Urokinase-type plasminogen activator PLAU protein protein human Homo sapiens Human MRALLARLLLCVLVVSDSKGSNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKPLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKEENGLAL DIP protein P00749 original sequence version: 130 62C72400BC23115F slurp1-plau-1 2 6 unspecified role unspecified role prey prey mouse-kidney Mus musculus kidney kidney [Renal] 4 unspecified role unspecified role bait bait n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association 4A slurp1-plau-2 3 6 unspecified role unspecified role prey prey mouse-kidney Mus musculus kidney kidney [Renal] 4 unspecified role unspecified role bait bait n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association 4B slurp1-plau-3 1 6 unspecified role unspecified role prey prey region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) Cleaved MBP-tagged PLAU/uPA also binds. However, the range of the binding peptide cannot be determined. 4 unspecified role unspecified role bait bait region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction 4C slurp1-plau-4 1 6 unspecified role unspecified role prey prey region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined mouse-kidney Mus musculus kidney kidney [Renal] 4 unspecified role unspecified role bait bait region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association 4C slurp1-plau-5 1 7 unspecified role unspecified role prey prey Recombinant protein has been used but expression system is not given in the publication 5 unspecified role unspecified role bait bait Recombinant protein has been used but expression system is not given in the publication direct interaction direct interaction 4C