UniProt UniProt http://www.uniprot.org The novel component Kgd4 recruits the E3 subunit to the mitochondrial α-ketoglutarate dehydrogenase. The novel component Kgd4 recruits the E3 subunit to the mitochondrial α-ketoglutarate dehydrogenase. Molecular biology of the cell 2014 imex curation Heublein M., Burguillos MA., Vögtle FN., Teixeira PF., Imhof A., Meisinger C., Ott M. martin.ott@dbb.su.se 15-Nov-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeast Saccharomyces cerevisiae Baker's yeast pull down pull down ms participant Identification by mass spectrometry ms participant Heublein M., Burguillos MA., Vögtle FN., Teixeira PF., Imhof A., Meisinger C., Ott M. martin.ott@dbb.su.se Accepted 2017-NOV-06 AT 10:41 GMT AT 10:41 GMT by PPORRAS Molecular biology of the cell 2014 Only protein-protein interactions imex curation imex curation OK, added but I'm not wild about it. These are supposed to be wild-type-/- cells, and this band is not visible in the total lysate. The novel component Kgd4 recruits the E3 subunit to the mitochondrial α-ketoglutarate dehydrogenase. The novel component Kgd4 recruits the E3 subunit to the mitochondrial α-ketoglutarate dehydrogenase. Molecular biology of the cell 2014 imex curation Heublein M., Burguillos MA., Vögtle FN., Teixeira PF., Imhof A., Meisinger C., Ott M. martin.ott@dbb.su.se 15-Nov-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeast Saccharomyces cerevisiae Baker's yeast pull down pull down western blot western blot Immuno blot Immuno blot Heublein M., Burguillos MA., Vögtle FN., Teixeira PF., Imhof A., Meisinger C., Ott M. martin.ott@dbb.su.se Accepted 2017-NOV-06 AT 10:41 GMT AT 10:41 GMT by PPORRAS Molecular biology of the cell 2014 Only protein-protein interactions imex curation imex curation OK, added but I'm not wild about it. These are supposed to be wild-type-/- cells, and this band is not visible in the total lysate. The novel component Kgd4 recruits the E3 subunit to the mitochondrial α-ketoglutarate dehydrogenase. The novel component Kgd4 recruits the E3 subunit to the mitochondrial α-ketoglutarate dehydrogenase. Molecular biology of the cell 2014 imex curation Heublein M., Burguillos MA., Vögtle FN., Teixeira PF., Imhof A., Meisinger C., Ott M. martin.ott@dbb.su.se 15-Nov-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeast Saccharomyces cerevisiae Baker's yeast crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Heublein M., Burguillos MA., Vögtle FN., Teixeira PF., Imhof A., Meisinger C., Ott M. Cross-linker bismaleimidehexane martin.ott@dbb.su.se Accepted 2017-NOV-06 AT 10:41 GMT AT 10:41 GMT by PPORRAS Molecular biology of the cell 2014 Only protein-protein interactions imex curation imex curation OK, added but I'm not wild about it. These are supposed to be wild-type-/- cells, and this band is not visible in the total lysate. odo1_yeast 2-oxoglutarate dehydrogenase, mitochondrial YIL125W KGD1 OGD1 Alpha-ketoglutarate dehydrogenase 2-oxoglutarate dehydrogenase complex component E1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MLRFVSSQTCRYSSRGLLKTSLLKNASTVKIVGRGLATTGTDNFLSTSNATYIDEMYQAWQKDPSSVHVSWDAYFKNMSNPKIPATKAFQAPPSISNFPQGTEAAPLGTAMTGSVDENVSIHLKVQLLCRAYQVRGHLKAHIDPLGISFGSNKNNPVPPELTLDYYGFSKHDLDKEINLGPGILPRFARDGKSKMSLKEIVDHLEKLYCSSYGVQYTHIPSKQKCDWLRERIEIPEPYQYTVDQKRQILDRLTWATSFESFLSTKFPNDKRFGLEGLESVVPGIKTLVDRSVELGVEDIVLGMAHRGRLNVLSNVVRKPNESIFSEFKGSSARDDIEGSGDVKYHLGMNYQRPTTSGKYVNLSLVANPSHLESQDPVVLGRTRALLHAKNDLKEKTKALGVLLHGDAAFAGQGVVYETMGFLTLPEYSTGGTIHVITNNQIGFTTDPRFARSTPYPSDLAKAIDAPIFHVNANDVEAVTFIFNLAAEWRHKFHTDAIIDVVGWRKHGHNETDQPSFTQPLMYKKIAKQKSVIDVYTEKLISEGTFSKKDIDEHKKWVWNLFEDAFEKAKDYVPSQREWLTAAWEGFKSPKELATEILPHEPTNVPESTLKELGKVLSSWPEGFEVHKNLKRILKNRGKSIETGEGIDWATGEALAFGTLVLDGQNVRVSGEDVERGTFSQRHAVLHDQQSEAIYTPLSTLNNEKADFTIANSSLSEYGVMGFEYGYSLTSPDYLVMWEAQFGDFANTAQVIIDQFIAGGEQKWKQRSGLVLSLPHGYDGQGPEHSSGRLERFLQLANEDPRYFPSEEKLQRQHQDCNFQVVYPTTPANLFHILRRQQHRQFRKPLALFFSKQLLRHPLARSSLSEFTEGGFQWIIEDIEHGKSIGTKEETKRLVLLSGQVYTALHKRRESLGDKTTAFLKIEQLHPFPFAQLRDSLNSYPNLEEIVWCQEEPLNMGSWAYTEPRLHTTLKETDKYKDFKVRYCGRNPSGAVAAGSKSLHLAEEDAFLKDVFQQS EF987C4DECE3F09F EF987C4DECE3F09F odo2_yeast Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial KGD2 YDR148C YD8358.05C Dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex 2-oxoglutarate dehydrogenase complex component E2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MLSRATRTAAAKSLVKSKVARNVMAASFVKRHASTSLFKQANKVESLGSIYLSGKKISVAANPFSITSNRFKSTSIEVPPMAESLTEGSLKEYTKNVGDFIKEDELLATIETDKIDIEVNSPVSGTVTKLNFKPEDTVTVGEELAQVEPGEAPAEGSGESKPEPTEQAEPSQGVAARENSSEETASKKEAAPKKEAAPKKEVTEPKKADQPKKTVSKAQEPPVASNSFTPFPRTETRVKMNRMRLRIAERLKESQNTAASLTTFNEVDMSALMEMRKLYKDEIIKKTGTKFGFMGLFSKACTLAAKDIPAVNGAIEGDQIVYRDYTDISVAVATPKGLVTPVVRNAESLSVLDIENEIVRLSHKARDGKLTLEDMTGGTFTISNGGVFGSLYGTPIINSPQTAVLGLHGVKERPVTVNGQIVSRPMMYLALTYDHRLLDGREAVTFLKTVKELIEDPRKMLLW C06FEB1DE385AE19 C06FEB1DE385AE19 rt31_yeast 37S ribosomal protein YMR-31, mitochondrial YFR049W YMR31 protein protein yeast Saccharomyces cerevisiae Baker's yeast MIATPIRLAKSAYEPMIKFVGTRHPLVKHATEVVVHPCATNGMLPGSKECIPVSKFMENYKPFRVVPIKHSANAGLSSSKTSVFVNRPLQKDELASIFELPARFRYKPINEHELESINSGGAW 25E491375CE7A137 dldh_yeast Dihydrolipoyl dehydrogenase, mitochondrial YFL018C LPD1 DHLP1 Dihydrolipoamide dehydrogenase Lipoamide dehydrogenase component of pyruvate dehydrogenase complex Pyruvate dehydrogenase complex E3 component Glycine decarboxylase complex subunit L protein protein yeast Saccharomyces cerevisiae Baker's yeast MLRIRSLLNNKRAFSSTVRTLTINKSHDVVIIGGGPAGYVAAIKAAQLGFNTACVEKRGKLGGTCLNVGCIPSKALLNNSHLFHQMHTEAQKRGIDVNGDIKINVANFQKAKDDAVKQLTGGIELLFKKNKVTYYKGNGSFEDETKIRVTPVDGLEGTVKEDHILDVKNIIVATGSEVTPFPGIEIDEEKIVSSTGALSLKEIPKRLTIIGGGIIGLEMGSVYSRLGSKVTVVEFQPQIGASMDGEVAKATQKFLKKQGLDFKLSTKVISAKRNDDKNVVEIVVEDTKTNKQENLEAEVLLVAVGRRPYIAGLGAEKIGLEVDKRGRLVIDDQFNSKFPHIKVVGDVTFGPMLAHKAEEEGIAAVEMLKTGHGHVNYNNIPSVMYSHPEVAWVGKTEEQLKEAGIDYKIGKFPFAANSRAKTNQDTEGFVKILIDSKTERILGAHIIGPNAGEMIAEAGLALEYGASAEDVARVCHAHPTLSEAFKEANMAAYDKAIHC 986A370F2E079DBC 986A370F2E079DBC kgd1-kgd2-2 1 6 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 5 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey association association Fig.1B ymr31-kgd1-1 2 6 unspecified role unspecified role bait bait c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 4 unspecified role unspecified role prey prey 5 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey association association Fig.1C lpd1-kgd1-1 2 6 unspecified role unspecified role prey prey 4 unspecified role unspecified role prey prey 5 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig.3C Interaction not observed in YMR31-/- cells although the interaction with Lpd1 still occurs. kgd1-kgd2-3 2 6 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 5 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey association association Fig.3D kgd1-kgd2-4 2 4 unspecified role unspecified role bait bait c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 5 unspecified role unspecified role prey prey physical association physical association Fig.3D Interaction observed in YMR31-/- cells ymr31-lpd1-2 2 6 unspecified role unspecified role bait bait c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 7 unspecified role unspecified role prey prey physical association physical association Fig.3E lpd1-kgd2-1 3 5 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig.4B Interaction decreased in YMR31-/- cells kgd1-kgd2-5 3 4 unspecified role unspecified role neutral component neutral component c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 5 unspecified role unspecified role neutral component neutral component physical association physical association Fig.4C ymr31-kgd1-2 2 6 unspecified role unspecified role bait bait c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c-terminal protein a tag protein a tag protein A protein A c-term range C-terminal range c-term range c-term range C-terminal range c-term range 7 unspecified role unspecified role prey prey 5 unspecified role unspecified role prey prey association association Fig.7B ymr31-kgd2-1 2 6 unspecified role unspecified role bait bait c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c-terminal protein a tag protein a tag protein A protein A c-term range C-terminal range c-term range c-term range C-terminal range c-term range 4 unspecified role unspecified role prey prey 5 unspecified role unspecified role prey prey association association Fig.7C