DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Protein competition switches the function of COP9 from self-renewal to differentiation. Protein competition switches the function of COP9 from self-renewal to differentiation. Nature 2014 imex curation Pan L., Wang S., Lu T., Weng C., Song X., Park JK., Sun J., Yang ZH., Yu J., Tang H., McKearin DM., Chamovitz DA., Ni J., Xie T. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Pan L., Wang S., Lu T., Weng C., Song X., Park JK., Sun J., Yang ZH., Yu J., Tang H., McKearin DM., Chamovitz DA., Ni J., Xie T. DIP original experiment: DIP-262344X Nature 2014 IMEx Protein competition switches the function of COP9 from self-renewal to differentiation. Protein competition switches the function of COP9 from self-renewal to differentiation. Protein competition switches the function of COP9 from self-renewal to differentiation. Nature 2014 imex curation Pan L., Wang S., Lu T., Weng C., Song X., Park JK., Sun J., Yang ZH., Yu J., Tang H., McKearin DM., Chamovitz DA., Ni J., Xie T. Only protein-protein interactions drome Drosophila melanogaster (Fruit fly) Fruit fly anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Pan L., Wang S., Lu T., Weng C., Song X., Park JK., Sun J., Yang ZH., Yu J., Tang H., McKearin DM., Chamovitz DA., Ni J., Xie T. DIP original experiment: DIP-262348X Nature 2014 IMEx Protein competition switches the function of COP9 from self-renewal to differentiation. Protein competition switches the function of COP9 from self-renewal to differentiation. Protein competition switches the function of COP9 from self-renewal to differentiation. Nature 2014 imex curation Pan L., Wang S., Lu T., Weng C., Song X., Park JK., Sun J., Yang ZH., Yu J., Tang H., McKearin DM., Chamovitz DA., Ni J., Xie T. Only protein-protein interactions drome Drosophila melanogaster (Fruit fly) Fruit fly anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Pan L., Wang S., Lu T., Weng C., Song X., Park JK., Sun J., Yang ZH., Yu J., Tang H., McKearin DM., Chamovitz DA., Ni J., Xie T. DIP original experiment: DIP-262342X Nature 2014 IMEx Protein competition switches the function of COP9 from self-renewal to differentiation. Protein competition switches the function of COP9 from self-renewal to differentiation. Protein competition switches the function of COP9 from self-renewal to differentiation. Nature 2014 imex curation Pan L., Wang S., Lu T., Weng C., Song X., Park JK., Sun J., Yang ZH., Yu J., Tang H., McKearin DM., Chamovitz DA., Ni J., Xie T. Only protein-protein interactions drome Drosophila melanogaster (Fruit fly) Fruit fly anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Pan L., Wang S., Lu T., Weng C., Song X., Park JK., Sun J., Yang ZH., Yu J., Tang H., McKearin DM., Chamovitz DA., Ni J., Xie T. DIP original experiment: DIP-262349X Nature 2014 IMEx Protein competition switches the function of COP9 from self-renewal to differentiation. Protein competition switches the function of COP9 from self-renewal to differentiation. Protein competition switches the function of COP9 from self-renewal to differentiation. Nature 2014 imex curation Pan L., Wang S., Lu T., Weng C., Song X., Park JK., Sun J., Yang ZH., Yu J., Tang H., McKearin DM., Chamovitz DA., Ni J., Xie T. Only protein-protein interactions drome Drosophila melanogaster (Fruit fly) Fruit fly anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Pan L., Wang S., Lu T., Weng C., Song X., Park JK., Sun J., Yang ZH., Yu J., Tang H., McKearin DM., Chamovitz DA., Ni J., Xie T. DIP original experiment: DIP-262339X Nature 2014 IMEx Protein competition switches the function of COP9 from self-renewal to differentiation. Protein competition switches the function of COP9 from self-renewal to differentiation. Protein competition switches the function of COP9 from self-renewal to differentiation. Nature 2014 imex curation Pan L., Wang S., Lu T., Weng C., Song X., Park JK., Sun J., Yang ZH., Yu J., Tang H., McKearin DM., Chamovitz DA., Ni J., Xie T. Only protein-protein interactions drome Drosophila melanogaster (Fruit fly) Fruit fly anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Pan L., Wang S., Lu T., Weng C., Song X., Park JK., Sun J., Yang ZH., Yu J., Tang H., McKearin DM., Chamovitz DA., Ni J., Xie T. DIP original experiment: DIP-262343X Nature 2014 IMEx Protein competition switches the function of COP9 from self-renewal to differentiation. Protein competition switches the function of COP9 from self-renewal to differentiation. Protein competition switches the function of COP9 from self-renewal to differentiation. Nature 2014 imex curation Pan L., Wang S., Lu T., Weng C., Song X., Park JK., Sun J., Yang ZH., Yu J., Tang H., McKearin DM., Chamovitz DA., Ni J., Xie T. Only protein-protein interactions drome Drosophila melanogaster (Fruit fly) Fruit fly anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Pan L., Wang S., Lu T., Weng C., Song X., Park JK., Sun J., Yang ZH., Yu J., Tang H., McKearin DM., Chamovitz DA., Ni J., Xie T. DIP original experiment: DIP-262345X Nature 2014 IMEx Protein competition switches the function of COP9 from self-renewal to differentiation. Protein competition switches the function of COP9 from self-renewal to differentiation. Protein competition switches the function of COP9 from self-renewal to differentiation. Nature 2014 imex curation Pan L., Wang S., Lu T., Weng C., Song X., Park JK., Sun J., Yang ZH., Yu J., Tang H., McKearin DM., Chamovitz DA., Ni J., Xie T. Only protein-protein interactions drome Drosophila melanogaster (Fruit fly) Fruit fly anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Pan L., Wang S., Lu T., Weng C., Song X., Park JK., Sun J., Yang ZH., Yu J., Tang H., McKearin DM., Chamovitz DA., Ni J., Xie T. DIP original experiment: DIP-262346X Nature 2014 IMEx Protein competition switches the function of COP9 from self-renewal to differentiation. Protein competition switches the function of COP9 from self-renewal to differentiation. Protein competition switches the function of COP9 from self-renewal to differentiation. Nature 2014 imex curation Pan L., Wang S., Lu T., Weng C., Song X., Park JK., Sun J., Yang ZH., Yu J., Tang H., McKearin DM., Chamovitz DA., Ni J., Xie T. Only protein-protein interactions drome Drosophila melanogaster (Fruit fly) Fruit fly anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Pan L., Wang S., Lu T., Weng C., Song X., Park JK., Sun J., Yang ZH., Yu J., Tang H., McKearin DM., Chamovitz DA., Ni J., Xie T. DIP original experiment: DIP-262341X Nature 2014 IMEx Protein competition switches the function of COP9 from self-renewal to differentiation. Protein competition switches the function of COP9 from self-renewal to differentiation. Protein competition switches the function of COP9 from self-renewal to differentiation. Nature 2014 imex curation Pan L., Wang S., Lu T., Weng C., Song X., Park JK., Sun J., Yang ZH., Yu J., Tang H., McKearin DM., Chamovitz DA., Ni J., Xie T. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Pan L., Wang S., Lu T., Weng C., Song X., Park JK., Sun J., Yang ZH., Yu J., Tang H., McKearin DM., Chamovitz DA., Ni J., Xie T. DIP original experiment: DIP-262338X Nature 2014 IMEx Protein competition switches the function of COP9 from self-renewal to differentiation. Protein competition switches the function of COP9 from self-renewal to differentiation. Protein competition switches the function of COP9 from self-renewal to differentiation. Nature 2014 imex curation Pan L., Wang S., Lu T., Weng C., Song X., Park JK., Sun J., Yang ZH., Yu J., Tang H., McKearin DM., Chamovitz DA., Ni J., Xie T. Only protein-protein interactions drome Drosophila melanogaster (Fruit fly) Fruit fly anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Pan L., Wang S., Lu T., Weng C., Song X., Park JK., Sun J., Yang ZH., Yu J., Tang H., McKearin DM., Chamovitz DA., Ni J., Xie T. DIP original experiment: DIP-262340X Nature 2014 IMEx Protein competition switches the function of COP9 from self-renewal to differentiation. Protein competition switches the function of COP9 from self-renewal to differentiation. Protein competition switches the function of COP9 from self-renewal to differentiation. Nature 2014 imex curation Pan L., Wang S., Lu T., Weng C., Song X., Park JK., Sun J., Yang ZH., Yu J., Tang H., McKearin DM., Chamovitz DA., Ni J., Xie T. Only protein-protein interactions drome Drosophila melanogaster (Fruit fly) Fruit fly anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Pan L., Wang S., Lu T., Weng C., Song X., Park JK., Sun J., Yang ZH., Yu J., Tang H., McKearin DM., Chamovitz DA., Ni J., Xie T. DIP original experiment: DIP-262347X Nature 2014 IMEx Protein competition switches the function of COP9 from self-renewal to differentiation. csn5_drome COP9 signalosome complex subunit 5 CSN5 CG14884 quo JAB1 homolog protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MDSDAAQKTWELENNIQTLPSCDEIFRYDAEQQRQIIDAKPWEKDPHFFKDIKISALALLKMVMHARSGGTLEVMGLMLGKVEDNTMIVMDAFALPVEGTETRVNAQAQAYEYMTAYMEAAKEVGRMEHAVGWYHSHPGYGCWLSGIDVSTQMLNQTYQEPFVAIVVDPVRTVSAGKVCLGAFRTYPKGYKPPNEEPSEYQTIPLNKIEDFGVHCKQYYPLEISYFKSALDRRLLDSLWNKYWVNTLGSSGLLTNTEYTTGQIMDLSEKLEQSENFLGRGTDVNEKRSEDKLSKATRDCSRSTIELIHGLMAQIVKDKLFNKVGLGK DIP protein Q9XZ58 original sequence version: 103 D0E94ED7ECC0ECF2 csn6_drome COP9 signalosome complex subunit 6 CSN6 CG6932 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MEQMEVDVDMSAKPSTSSSAAAGSSMAVDKTADQNPQPQGNIMAAAGTSGSVTISLHPLVIMNISEHWTRFRAQHGEPRQVYGALIGKQKGRNIEIMNSFELKTDVIGDETVINKDYYNKKEQQYKQVFSDLDFIGWYTTGDNPTADDIKIQRQIAAINECPIMLQLNPLSRSVDHLPLKLFESLIDLVDGEATMLFVPLTYTLATEEAERIGVDHVARMTSNESGEKSVVAEHLVAQDSAIKMLNTRIKIVLQYIRDVEAGKLRANQEILREAYALCHRLPVMQVPAFQEEFYTQCNDVGLISYLGTLTKGCNDMHHFVNKFNMLYDRQGSARRMRGLYY DIP protein Q9VCY3 original sequence version: 88 CA9C05F03593C47A bgcn_drome Benign gonial cell neoplasm protein bgcn b(2)gcn CG30170 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MNHIIQDKYIPQQLLYFLAGRRCCQQFPCTFRTSEHEAFANNARSLGLRSQVVHVNGNSCVKVYKQACRHYLEEPKTLVLSSGATLNMFTLLSRKSLMGKEDLELYADLVSMKANASDLPSLHLPLPAIRPPNLRFWTEAQLNFLTAFLGHSLSDEILQSLYASRVIVYNAALCWDKSVFLPLVILDDCRNKKSNVKIMCIERQAILATYNSQRTANFFGEQLGETVGIQLPYFSAVSSSTFIIYSTAQYFLRSLTSQQFRNISHLVVNDVHLHDPYTDILLSEIRMALSSHQNLRVVLLSQMGNPKKFTDFFGEGLQLNMIKQPEVAPRVSYLNELHSCIALAGIHKGPDIYKEIPEAFRANNPRNEQMDKCLQAYGELGTDAALRPFLYAVNYDLAPVNYRHSLTGKTAVHFASELNKANHLRLLLFMGADPYIVDLFQQNAISLAAMNGNHECIDVLNSYSLHGYVVKSAKPDFVDYDLIIDIMYLLRTKPEYSPGEYSPGNILIILPTYYHIVKLNYMILSHCLTGSLQECSIFLLYDNMRNDYLQALVNASDETVKVVLATDIIESLCLKVPFKYQIDTACRLNNVYDTTSCSGDDRFEWVAKDALLRRELILQPNKGDVQCFRLISKEAYEELSETSQPSLQTMQLDKICLAVKLLSPNTIISEYLGITISPPPLINVHHAVQFLKKIDVLDDAEDVTWLGCRLMDIPVSCQLGRMLIFGILLRCLDPILTIVSSLSTADPLGIPFTEDIDNLWDRFTIYIQNSIKKERTYLSDNQFSDHFIFVRLYKEWQNRMHNRTPPLYLKDEYEFMLNGLMEQLTSIRSEIVSSLRAANLIHSRGKLSMNNLNQMSCNWHMVKAALTGGMYPNIYAVDTRKSSLKSAFSGNVSMHPNTVLRDFLEPLNISAQSFRTPWIVCNRQKSHIVYATLVVPLAVAMFSGHPRIRLSPICDSEMSLTDRNVNVFIDEWIWMVMSKATAEMVMRTRYYFFKMYHDLLKHCSELDMWRRDCEPVSQYTVLTDTLSKIFESEDGFVGFFKPPPITFLPTPQLPSLYLLSVNAHFSWAREVEENMLSKPHHFNSHFIERQFFVLYAGGDCEEFHSRNTPAFIESVLGKFVRPIDTPNRHIFVILYRKDPDMMLSISRAKFVNGVFMLQEYFRNNIPVFEILDACVSLNVQTPVFDGRLMSALIDKRVGNLIMELFAFRHHWIHKR DIP protein Q9W1I2 original sequence version: 87 DIP protein Q9W1I2 original sequence version: 110 DIP protein Q9W1I2 original sequence version: 113 11F83C1B3816F2CD csn4_drome COP9 signalosome complex subunit 4 CSN4 CG8725 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MAANYGISTAALRSQLMGLINFTGTHKDQADKYRQLLKTVLTNTGQELIDGLRLFVEAIVNEHVSLVISRQILNDVGSELSKLPDDLSKMLSHFTLEKVNPRVISFEEQVAGIRFHLANIYERNQQWRDAATVLVGIPLETGQKQYSVECKLGTYLKIARLYLEDNDSVQAELFINRASLLQAETNSEELQVLYKVCYARVLDYRRKFIEAAQRYNELSYRKIVDQGERMTALKKALICTVLASAGQQRSRMLATLFKDERCQHLPAYGILEKMYLERIIRRSELQEFEALLQDHQKAATSDGSSILDRAVFEHNLLSASKLYNNITFEELGALLDIPAVKAEKIASQMITEGRMNGHIDQISAIVHFENRELLPQWDRQIQSLCYQVNSIIEKISVAEPDWMDNLN DIP protein Q9V345 original sequence version: 98 BB7B552ABC8848F0 csn7_drome COP9 signalosome complex subunit 7 CSN7 CG2038 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MTQDMLLGNEEPSKSKETFLEKFCVLAKSSTGAALLDVIRQALEAPNVFVFGELLAEPSVLQLKDGPDSKHFETLNLFAYGTYKEYRAQPEKFIELTPAMQKKLQHLTIVSLAIKAKSIPYALLLSELEIDNVRHLEDIIIEAIYADIIHGKLFQNTRILEVDYAQGRDIPPGYTGQIVETLQAWVNSCDSVSNCIEMQIKYANAEKSKRLINKERVEQDLINLKKVLKSQTSDSDESMQIDTHGPGTSGGLGQSELRKKPSKLRNPRSAAVGLKFSK DIP protein Q9V4S8 original sequence version: 82 CAB00E6C0E0A9BA8 bam_drome Protein bag-of-marbles bam CG10422 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MLNARDVCPEGNDDQQLDHNFKQMEEHLALMVEGNENEDPRKATCEYEDTNEDGATCTSGVLSEIQENFGRLRLCDVTAPLLEFHGLDCLQQIQKRSRHFAFDGSPAKKSRSGGVLVTGPKQKQLQKENVWNRKSKGSASADNIEKLPITIEKLHMIGLHGDCLEHNAVLRLMNLFRSLHDHLTADLGFSRQNSMPSDYLFDMPVKSTMPKSLNVRYQLQVLCTKVERFLVQQRRTLEANRHFDFEKYDECDKLLKGFASYLDNFKLLLKPKMRNRNGNSGSNADKFHTQRMERLLIGLRDWIKAAHLSVHVFNWEMDLEHRYSGAMTESHKSLNERAILLSGAELRAAEARGISAEDLFIAQRYKLGGPIYCVLEQHEFLSALIANPETYFPPSVVAICGPQKLGAVSMEQPSASEEEFEETEEVPSSPPRHTGRVPRFRS DIP protein P22745 original sequence version: 75 DIP protein P22745 original sequence version: 91 DIP protein P22745 original sequence version: 94 D2FE2BCFC249F254 csn6-csn5-1 2 14 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range drome Drosophila melanogaster (Fruit fly) Fruit fly 13 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range drome Drosophila melanogaster (Fruit fly) Fruit fly physical association physical association bam-csn4-1 10 16 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 18 unspecified role unspecified role bait bait Region 151-300 Region 151-300 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Region 201-350 Region 201-350 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association bam-bgcn-6 11 15 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range drome Drosophila melanogaster (Fruit fly) Fruit fly 16 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range drome Drosophila melanogaster (Fruit fly) Fruit fly 18 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range drome Drosophila melanogaster (Fruit fly) Fruit fly association association csn4-csn6-2 8 14 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range drome Drosophila melanogaster (Fruit fly) Fruit fly 16 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range drome Drosophila melanogaster (Fruit fly) Fruit fly physical association physical association bam-bgcn-7 1 15 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 18 unspecified role unspecified role bait bait Region 101-350 Region 101-350 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association bam-csn4-2 3 16 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range drome Drosophila melanogaster (Fruit fly) Fruit fly 18 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range Region 101-300 Region 101-300 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain drome Drosophila melanogaster (Fruit fly) Fruit fly physical association physical association csn6-csn7-1 4 17 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range drome Drosophila melanogaster (Fruit fly) Fruit fly 14 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range drome Drosophila melanogaster (Fruit fly) Fruit fly physical association physical association csn4-bam-1 5 16 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range drome Drosophila melanogaster (Fruit fly) Fruit fly 18 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly physical association physical association csn4-csn7-3 12 17 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range drome Drosophila melanogaster (Fruit fly) Fruit fly 16 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range drome Drosophila melanogaster (Fruit fly) Fruit fly physical association physical association bam-bgcn-8 9 15 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range drome Drosophila melanogaster (Fruit fly) Fruit fly 18 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range Region 101-400 Region 101-400 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain drome Drosophila melanogaster (Fruit fly) Fruit fly physical association physical association csn4-csn5-1 7 13 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range drome Drosophila melanogaster (Fruit fly) Fruit fly 16 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range drome Drosophila melanogaster (Fruit fly) Fruit fly physical association physical association bam-csn4-3 6 16 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Region 287-407 Region 287-407 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain drome Drosophila melanogaster (Fruit fly) Fruit fly 18 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range drome Drosophila melanogaster (Fruit fly) Fruit fly physical association physical association