DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structural basis for lipopolysaccharide insertion in the bacterial outer membrane. Structural basis for lipopolysaccharide insertion in the bacterial outer membrane. Nature 2014 imex curation Qiao S., Luo Q., Zhao Y., Zhang XC., Huang Y. Only protein-protein interactions ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Qiao S., Luo Q., Zhao Y., Zhang XC., Huang Y. DIP original experiment: DIP-262087X Nature 2014 IMEx Structural basis for lipopolysaccharide insertion in the bacterial outer membrane. Structural basis for lipopolysaccharide insertion in the bacterial outer membrane. Structural basis for lipopolysaccharide insertion in the bacterial outer membrane. Nature 2014 imex curation Qiao S., Luo Q., Zhao Y., Zhang XC., Huang Y. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Qiao S., Luo Q., Zhao Y., Zhang XC., Huang Y. DIP original experiment: DIP-262090X Nature 2014 IMEx Structural basis for lipopolysaccharide insertion in the bacterial outer membrane. Structural basis for lipopolysaccharide insertion in the bacterial outer membrane. Structural basis for lipopolysaccharide insertion in the bacterial outer membrane. Nature 2014 imex curation Qiao S., Luo Q., Zhao Y., Zhang XC., Huang Y. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Qiao S., Luo Q., Zhao Y., Zhang XC., Huang Y. DIP original experiment: DIP-262089X Nature 2014 IMEx Structural basis for lipopolysaccharide insertion in the bacterial outer membrane. Structural basis for lipopolysaccharide insertion in the bacterial outer membrane. Structural basis for lipopolysaccharide insertion in the bacterial outer membrane. Nature 2014 imex curation Qiao S., Luo Q., Zhao Y., Zhang XC., Huang Y. Only protein-protein interactions ecolx Escherichia coli ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom predetermined predetermined participant predetermined Qiao S., Luo Q., Zhao Y., Zhang XC., Huang Y. DIP original experiment: DIP-262088X Nature 2014 IMEx Structural basis for lipopolysaccharide insertion in the bacterial outer membrane. lpte_shifl LPS-assembly lipoprotein LptE lptE rlpB SF0640 S0662 protein protein shifl Shigella flexneri MRYLATLLLSLAVLITAGCGWHLRDTTQVPSTMKVMILDSGDPNGPLSRAVRNQLRLNGVELLDKETTRKDVPSLRLGKVSIAKDTASVFRNGQTAEYQMIMTVNATVLIPGRDIYPISAKVFRSFFDNPQMALAKDNEQDMIVKEMYDRAAEQLIRKLPSIRAADIRSDEEQTSTTTDTPATPARVSTMLGN DIP protein Q83LX4 original sequence version: 76 lptd_shifl LPS-assembly protein LptD lptD imp ostA SF0051 S0053 protein protein shifl Shigella flexneri MKKRIPTLLATMIATALYSQQGLAADLASQCMLGVPSYDRPLVQGDTNDLPVTINADHAKGDYPDDAVFTGSVDIMQGNSRLQADEVQLHQKEAPGQPEPVRTVDALGNVHYDDNQVILKGPKGWANLNTKDTNVWEGDYQMVGRQGRGKADLMKQRGENRYTILDNGSFTSCLPGSDTWSVVGSEIIHDREEQVAEIWNARFKVGPVPIFYSPYLQLPVGDKRRSGFLIPNAKYTTTNYFEFYLPYYWNIAPNMDATITPHYMHRRGNIMWENEFRYLSQAGAGLMELDYLPSDKVYEDEHPNDDSSRRWLFYWNHSGVMDQVWRFNVDYTKVSDPSYFNDFDNKYGSSTDGYATQKFSVGYAVQNFNATVSTKQFQVFSEQNTSSYSAEPQLDVNYYQNDVGPFDTRIYGQAVHFVNTRDDMPEATRVHLEPTINLPLSNNWGSINTEAKFLATHYQQTNLDWYNSRNTTKLDESVNRVMPQFKVDGKMVFERDMEMLAPGYTQTLEPRAQYLYVPYRDQSDIYNYDSSLLQSDYSGLFRDRTYGGLDRIASANQVTTGVTSRIYDDAAVERFNISVGQIYYFTESRTGDDNITWENDDKTGSLVWAGDTYWRISERWGLRGGIQYDTRLDNVATSNSSIEYRRDEDRLVQLNYHYASPEYIQATLPKYYSTAEQYKNGISQVGAVASRPIADRWSIVGAYYYDTNANKQADSMLGVQYSSCCYAIRVGYERKLNGWDNDKQHAVYDNAIGFNIELRGLSSNYGLGTQEMLRSNILPYQNTL DIP protein Q83SQ0 original sequence version: 68 lpte-lptd-4 1 6 unspecified role unspecified role prey prey Region 25-784 Region 25-784 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 5 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Region 19-193 Region 19-193 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association lptd-lpte-7 3 6 unspecified role unspecified role unspecified role unspecified role Region 25-784 Region 25-784 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 5 unspecified role unspecified role unspecified role unspecified role Region 19-193 Region 19-193 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction lptd-lpte-8 4 6 unspecified role unspecified role unspecified role unspecified role Region 25-784 Region 25-784 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 5 unspecified role unspecified role unspecified role unspecified role Region 19-193 Region 19-193 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction lptd-lpte-9 2 6 unspecified role unspecified role unspecified role unspecified role Region 25-784 Region 25-784 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 5 unspecified role unspecified role unspecified role unspecified role Region 19-193 Region 19-193 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction