DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex. Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex. Science (New York, N.Y.) 2014 imex curation Lee K., Zhong X., Gu S., Kruel AM., Dorner MB., Perry K., Rummel A., Dong M., Jin R. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Lee K., Zhong X., Gu S., Kruel AM., Dorner MB., Perry K., Rummel A., Dong M., Jin R. DIP original experiment: DIP-266386X Science (New York, N.Y.) 2014 IMEx Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex. Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex. Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex. Science (New York, N.Y.) 2014 imex curation Lee K., Zhong X., Gu S., Kruel AM., Dorner MB., Perry K., Rummel A., Dong M., Jin R. Only protein-protein interactions ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Lee K., Zhong X., Gu S., Kruel AM., Dorner MB., Perry K., Rummel A., Dong M., Jin R. DIP original experiment: DIP-266390X Science (New York, N.Y.) 2014 IMEx Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex. Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex. Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex. Science (New York, N.Y.) 2014 imex curation Lee K., Zhong X., Gu S., Kruel AM., Dorner MB., Perry K., Rummel A., Dong M., Jin R. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Lee K., Zhong X., Gu S., Kruel AM., Dorner MB., Perry K., Rummel A., Dong M., Jin R. DIP original experiment: DIP-266378X Science (New York, N.Y.) 2014 IMEx Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex. Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex. Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex. Science (New York, N.Y.) 2014 imex curation Lee K., Zhong X., Gu S., Kruel AM., Dorner MB., Perry K., Rummel A., Dong M., Jin R. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Lee K., Zhong X., Gu S., Kruel AM., Dorner MB., Perry K., Rummel A., Dong M., Jin R. DIP original experiment: DIP-266381X Science (New York, N.Y.) 2014 IMEx Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex. Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex. Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex. Science (New York, N.Y.) 2014 imex curation Lee K., Zhong X., Gu S., Kruel AM., Dorner MB., Perry K., Rummel A., Dong M., Jin R. Only protein-protein interactions ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Lee K., Zhong X., Gu S., Kruel AM., Dorner MB., Perry K., Rummel A., Dong M., Jin R. DIP original experiment: DIP-266387X Science (New York, N.Y.) 2014 IMEx Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex. Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex. Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex. Science (New York, N.Y.) 2014 imex curation Lee K., Zhong X., Gu S., Kruel AM., Dorner MB., Perry K., Rummel A., Dong M., Jin R. Only protein-protein interactions ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Lee K., Zhong X., Gu S., Kruel AM., Dorner MB., Perry K., Rummel A., Dong M., Jin R. DIP original experiment: DIP-266393X Science (New York, N.Y.) 2014 IMEx Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex. Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex. Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex. Science (New York, N.Y.) 2014 imex curation Lee K., Zhong X., Gu S., Kruel AM., Dorner MB., Perry K., Rummel A., Dong M., Jin R. Only protein-protein interactions ecolx Escherichia coli ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom predetermined predetermined participant predetermined Lee K., Zhong X., Gu S., Kruel AM., Dorner MB., Perry K., Rummel A., Dong M., Jin R. DIP original experiment: DIP-266394X Science (New York, N.Y.) 2014 IMEx Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex. Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex. Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex. Science (New York, N.Y.) 2014 imex curation Lee K., Zhong X., Gu S., Kruel AM., Dorner MB., Perry K., Rummel A., Dong M., Jin R. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Lee K., Zhong X., Gu S., Kruel AM., Dorner MB., Perry K., Rummel A., Dong M., Jin R. DIP original experiment: DIP-266380X Science (New York, N.Y.) 2014 IMEx Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex. Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex. Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex. Science (New York, N.Y.) 2014 imex curation Lee K., Zhong X., Gu S., Kruel AM., Dorner MB., Perry K., Rummel A., Dong M., Jin R. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Lee K., Zhong X., Gu S., Kruel AM., Dorner MB., Perry K., Rummel A., Dong M., Jin R. DIP original experiment: DIP-266382X Science (New York, N.Y.) 2014 IMEx Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex. Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex. Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex. Science (New York, N.Y.) 2014 imex curation Lee K., Zhong X., Gu S., Kruel AM., Dorner MB., Perry K., Rummel A., Dong M., Jin R. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Lee K., Zhong X., Gu S., Kruel AM., Dorner MB., Perry K., Rummel A., Dong M., Jin R. DIP original experiment: DIP-266377X Science (New York, N.Y.) 2014 IMEx Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex. Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex. Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex. Science (New York, N.Y.) 2014 imex curation Lee K., Zhong X., Gu S., Kruel AM., Dorner MB., Perry K., Rummel A., Dong M., Jin R. Only protein-protein interactions ecolx Escherichia coli ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom predetermined predetermined participant predetermined Lee K., Zhong X., Gu S., Kruel AM., Dorner MB., Perry K., Rummel A., Dong M., Jin R. DIP original experiment: DIP-266388X Science (New York, N.Y.) 2014 IMEx Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex. Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex. Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex. Science (New York, N.Y.) 2014 imex curation Lee K., Zhong X., Gu S., Kruel AM., Dorner MB., Perry K., Rummel A., Dong M., Jin R. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Lee K., Zhong X., Gu S., Kruel AM., Dorner MB., Perry K., Rummel A., Dong M., Jin R. DIP original experiment: DIP-266379X Science (New York, N.Y.) 2014 IMEx Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex. Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex. Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex. Science (New York, N.Y.) 2014 imex curation Lee K., Zhong X., Gu S., Kruel AM., Dorner MB., Perry K., Rummel A., Dong M., Jin R. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Lee K., Zhong X., Gu S., Kruel AM., Dorner MB., Perry K., Rummel A., Dong M., Jin R. DIP original experiment: DIP-266384X Science (New York, N.Y.) 2014 IMEx Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex. Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex. Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex. Science (New York, N.Y.) 2014 imex curation Lee K., Zhong X., Gu S., Kruel AM., Dorner MB., Perry K., Rummel A., Dong M., Jin R. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Lee K., Zhong X., Gu S., Kruel AM., Dorner MB., Perry K., Rummel A., Dong M., Jin R. DIP original experiment: DIP-266392X Science (New York, N.Y.) 2014 IMEx Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex. Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex. Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex. Science (New York, N.Y.) 2014 imex curation Lee K., Zhong X., Gu S., Kruel AM., Dorner MB., Perry K., Rummel A., Dong M., Jin R. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Lee K., Zhong X., Gu S., Kruel AM., Dorner MB., Perry K., Rummel A., Dong M., Jin R. DIP original experiment: DIP-266385X Science (New York, N.Y.) 2014 IMEx Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex. Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex. Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex. Science (New York, N.Y.) 2014 imex curation Lee K., Zhong X., Gu S., Kruel AM., Dorner MB., Perry K., Rummel A., Dong M., Jin R. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Lee K., Zhong X., Gu S., Kruel AM., Dorner MB., Perry K., Rummel A., Dong M., Jin R. DIP original experiment: DIP-266395X Science (New York, N.Y.) 2014 IMEx Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex. Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex. Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex. Science (New York, N.Y.) 2014 imex curation Lee K., Zhong X., Gu S., Kruel AM., Dorner MB., Perry K., Rummel A., Dong M., Jin R. Only protein-protein interactions ecolx Escherichia coli ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom predetermined predetermined participant predetermined Lee K., Zhong X., Gu S., Kruel AM., Dorner MB., Perry K., Rummel A., Dong M., Jin R. DIP original experiment: DIP-266391X Science (New York, N.Y.) 2014 IMEx Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex. Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex. Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex. Science (New York, N.Y.) 2014 imex curation Lee K., Zhong X., Gu S., Kruel AM., Dorner MB., Perry K., Rummel A., Dong M., Jin R. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Lee K., Zhong X., Gu S., Kruel AM., Dorner MB., Perry K., Rummel A., Dong M., Jin R. DIP original experiment: DIP-266389X Science (New York, N.Y.) 2014 IMEx Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex. Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex. Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex. Science (New York, N.Y.) 2014 imex curation Lee K., Zhong X., Gu S., Kruel AM., Dorner MB., Perry K., Rummel A., Dong M., Jin R. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Lee K., Zhong X., Gu S., Kruel AM., Dorner MB., Perry K., Rummel A., Dong M., Jin R. DIP original experiment: DIP-266383X Science (New York, N.Y.) 2014 IMEx Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex. cadh1_mouse Cadherin-1 Epithelial cadherin Uvomorulin ARC-1 Cdh1 protein protein mouse Mus musculus Mouse MGARCRSFSALLLLLQVSSWLCQELEPESCSPGFSSEVYTFPVPERHLERGHVLGRVRFEGCTGRPRTAFFSEDSRFKVATDGTITVKRHLKLHKLETSFLVRARDSSHRELSTKVTLKSMGHHHHRHHHRDPASESNPELLMFPSVYPGLRRQKRDWVIPPISCPENEKGEFPKNLVQIKSNRDKETKVFYSITGQGADKPPVGVFIIERETGWLKVTQPLDREAIAKYILYSHAVSSNGEAVEDPMEIVITVTDQNDNRPEFTQEVFEGSVAEGAVPGTSVMKVSATDADDDVNTYNAAIAYTIVSQDPELPHKNMFTVNRDTGVISVLTSGLDRESYPTYTLVVQAADLQGEGLSTTAKAVITVKDINDNAPVFNPSTYQGQVPENEVNARIATLKVTDDDAPNTPAWKAVYTVVNDPDQQFVVVTDPTTNDGILKTAKGLDFEAKQQYILHVRVENEEPFEGSLVPSTATVTVDVVDVNEAPIFMPAERRVEVPEDFGVGQEITSYTAREPDTFMDQKITYRIWRDTANWLEINPETGAIFTRAEMDREDAEHVKNSTYVALIIATDDGSPIATGTGTLLLVLLDVNDNAPIPEPRNMQFCQRNPQPHIITILDPDLPPNTSPFTAELTHGASVNWTIEYNDAAQESLILQPRKDLEIGEYKIHLKLADNQNKDQVTTLDVHVCDCEGTVNNCMKAGIVAAGLQVPAILGILGGILALLILILLLLLFLRRRTVVKEPLLPPDDDTRDNVYYYDEEGGGEEDQDFDLSQLHRGLDARPEVTRNDVAPTLMSVPQYRPRPANPDEIGNFIDENLKAADSDPTAPPYDSLLVFDYEGSGSEAASLSSLNSSESDQDQDYDYLNEWGNRFKKLADMYGGGEDD DIP protein P09803 original sequence version: 92 DIP protein P09803 original sequence version: 116 DIP protein P09803 original sequence version: 124 DIP protein P09803 original sequence version: 128 DIP protein P09803 original sequence version: 141 DIP protein P09803 original sequence version: 174 7A6444148D3D5983 a5hzz4_clobh ha70 CBO0801 protein protein clobh Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) MNSSIKKIYNDIQEKVINYSDTIDLADGNYVVRRGDGWILSRQNQILGGSVISNGSTGIVGDLRVNDNAIPYYYPTPSFNEEYIKNNIQTVFTNFTEANQIPIGFEFSKTAPSNKNLYMYLQYTYIRYEIIKVLQHEIIERAVLYVPSLGYVKSIEFNPGEKINKDFYFLTNDKCILNEQFLYKKILETTKNIPTNNIFNSKVSSTQRVLPYSNGLYVINKGDGYIRTNDKDLIGTLLIEAGSSGSIIQPRLRNTTRPLFTTSNDTKFSQQYTEERLKDAFNVQLFNTSTSLFKFVEEAPSDKNICIKAYNTYEKYELIDYQNGSIVNKAEYYLPSLGYCEVTNAPSPESEVVKMQVAEDGFIQNGPEEEIVVGVIDPSENIQEINTAISDNYTYNIPGIVNNNPFYILFTVNTTGIYKINAQNNLPSLKIYEAIGSGNRNFQSGNLCDDDIKAINYITGFDSPNAKSYLVVLLNKDKNYYIRVPQTSSNIENQIQFKREEGDLRNLMNSSVNIIDNLNSTGAHYYTRQSPDVHDYISYEFTIPGNFNNKDTSNIRLYTSYNQGIGTLFRVTETIDGYNLINIQQNLHLLNNTNSIRLLNGAIYILKVEVTELNNYNIRLHIDITN DIP protein A5HZZ4 original sequence version: 56 bxan_clobo Non-toxic nonhemagglutinin type A ant ntnh ACP52_06665 Botulinum neurotoxin type A non-toxic component protein protein clobo Clostridium botulinum MNINDNLSINSPVDNKNVVVVRARKTDTVFKAFKVAPNIWVAPERYYGESLSIDEEYKVDGGIYDSNFLSQDSEKDKFLQAIITLLKRINSTNAGEKLLSLISTAIPFPYGYIGGGYYAPNMITFGSAPKSNKKLNSLISSTIPFPYAGYRETNYLSSEDNKSFYASNIVIFGPGANIVENNTVFYKKEDAENGMGTMTEIWFQPFLTYKYDEFYIDPAIELIKCLIKSLYFLYGIKPSDDLVIPYRLRSELENIEYSQLNIVDLLVSGGIDPKFINTDPYWFTDNYFSNAKKVFEDHRNIYETEIEGNNAIGNDIKLRLKQKFRININDIWELNLNYFSKEFSIMMPDRFNNALKHFYRKQYYKIDYPENYSINGFVNGQINAQLSLSDRNQDIINKPEEIINLLNGNNVSLMRSNIYGDGLKSTVDDFYSNYKIPYNRAYEYHFNNSNDSSLDNVNIGVIDNIPEIIDVNPYKENCDKFSPVQKITSTREINTNIPWPINYLQAQNTNNEKFSLSSDFVEVVSSKDKSLVYSFLSNVMFYLDSIKDNSPIDTDKKYYLWLREIFRNYSFDITATQEINTNCGINKVVTWFGKALNILNTSDSFVEEFQNLGAISLINKKENLSMPIIESYEIPNDMLGLPLNDLNEKLFNIYSKNTAYFKKIYYNFLDQWWTQYYSQYFDLICMAKRSVLAQETLIKRIIQKKLSYLIGNSNISSDNLALMNLTTTNTLRDISNESQIAMNNVDSFLNNAAICVFESNIYPKFISFMEQCINNINIKTKEFIQKCTNINEDEKLQLINQNVFNSLDFEFLNIQNMKSLFSSETALLIKEETWPYELVLYAFKEPGNNVIGDASGKNTSIEYSKDIGLVYGINSDALYLNGSNQSISFSNDFFENGLTNSFSIYFWLRNLGKDTIKSKLIGSKEDNCGWEIYFQDTGLVFNMIDSNGNEKNIYLSDVSNNSWHYITISVDRLKEQLLIFIDDNLVANESIKEILNIYSSNIISLLSENNPSYIEGLTILNKPTTSQEVLSNYFEVLNNSYIRDSNEERLEYNKTYQLYNYVFSDKPICEVKQNNNIYLTINNTNNLNLQASKFKLLSINPNKQYVQKLDEVIISVLDNMEKYIDISEDNRLQLIDNKNNAKKMIISNDIFISNCLTLSYNGKYICLSMKDENHNWMICNNDMSKYLYLWSFK DIP protein Q45914 original sequence version: 88 a5hzz5_clobh ha17 CBO0802 protein protein clobh Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) MSVERTFLPNGNYNIKSIFSGSLYLNPVSKSLTFSNESSANNQKWNVEYMAENRCFKISNVAEPNKYLSYDNFGFISLDSLSNRCYWFPIKIAVNTYIMLSLNKVNELDYAWDIYDTNENILSQPLLLLPNFDIYNSNQMFKLEKI DIP protein A5HZZ5 original sequence version: 57 bxa1_clobh Botulinum neurotoxin type A botA Bontoxilysin-A CBO0806 CLC_0862 protein protein clobh Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) MPFVNKQFNYKDPVNGVDIAYIKIPNAGQMQPVKAFKIHNKIWVIPERDTFTNPEEGDLNPPPEAKQVPVSYYDSTYLSTDNEKDNYLKGVTKLFERIYSTDLGRMLLTSIVRGIPFWGGSTIDTELKVIDTNCINVIQPDGSYRSEELNLVIIGPSADIIQFECKSFGHEVLNLTRNGYGSTQYIRFSPDFTFGFEESLEVDTNPLLGAGKFATDPAVTLAHELIHAGHRLYGIAINPNRVFKVNTNAYYEMSGLEVSFEELRTFGGHDAKFIDSLQENEFRLYYYNKFKDIASTLNKAKSIVGTTASLQYMKNVFKEKYLLSEDTSGKFSVDKLKFDKLYKMLTEIYTEDNFVKFFKVLNRKTYLNFDKAVFKINIVPKVNYTIYDGFNLRNTNLAANFNGQNTEINNMNFTKLKNFTGLFEFYKLLCVRGIITSKTKSLDKGYNKALNDLCIKVNNWDLFFSPSEDNFTNDLNKGEEITSDTNIEAAEENISLDLIQQYYLTFNFDNEPENISIENLSSDIIGQLELMPNIERFPNGKKYELDKYTMFHYLRAQEFEHGKSRIALTNSVNEALLNPSRVYTFFSSDYVKKVNKATEAAMFLGWVEQLVYDFTDETSEVSTTDKIADITIIIPYIGPALNIGNMLYKDDFVGALIFSGAVILLEFIPEIAIPVLGTFALVSYIANKVLTVQTIDNALSKRNEKWDEVYKYIVTNWLAKVNTQIDLIRKKMKEALENQAEATKAIINYQYNQYTEEEKNNINFNIDDLSSKLNESINKAMININKFLNQCSVSYLMNSMIPYGVKRLEDFDASLKDALLKYIYDNRGTLIGQVDRLKDKVNNTLSTDIPFQLSKYVDNQRLLSTFTEYIKNIINTSILNLRYESNHLIDLSRYASKINIGSKVNFDPIDKNQIQLFNLESSKIEVILKNAIVYNSMYENFSTSFWIRIPKYFNSISLNNEYTIINCMENNSGWKVSLNYGEIIWTLQDTQEIKQRVVFKYSQMINISDYINRWIFVTITNNRLNNSKIYINGRLIDQKPISNLGNIHASNNIMFKLDGCRDTHRYIWIKYFNLFDKELNEKEIKDLYDNQSNSGILKDFWGDYLQYDKPYYMLNLYDPNKYVDVNNVGIRGYMYLKGPRGSVMTTNIYLNSSLYRGTKFIIKKYASGNKDNIVRNNDRVYINVVVKNKEYRLATNASQAGVEKILSALEIPDVGNLSQVVVMKSKNDQGITNKCKMNLQDNNGNDIGFIGFHQFNNIAKLVASNWYNRQIERSSRTLGCSWEFIPVDDGWGERPL DIP protein A5HZZ9 original sequence version: 69 a5hzz6_clobh ha33 CBO0803 protein protein clobh Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) MEHYSVIQNSLNDKIVTISCKADTNLFFYQVAGNVSLFQQTRNYLERWRLIYDSNKAAYKIKSMDIHNTNLVLTWNAPTHNISTQQDSNADNQYWLLLKDIGNNSFIIASYKNPNLVLYADTVARNLKLSTLNNSNYIKFIIEDYIISDLNNFTCKISPILDLNKVVQQVDVTNLNVNLYTWDYGRNQKWTIRYNEEKAAYQFFNTILSNGVLTWIFSNGNTVRVSSSNDQNNDAQYWLINPVSDTDETYTITNLRDTTKALDLYGGQTANGTAIQVFNYHGDDNQKWNIRNP DIP protein A5HZZ6 original sequence version: 57 ha70-cdh1-1 8 20 unspecified role unspecified role prey prey Region 157-369 Region 157-369 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 21 unspecified role unspecified role bait bait Region 378-626 Region 378-626 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 23 unspecified role unspecified role prey prey ecolx Escherichia coli 25 unspecified role unspecified role prey prey ecolx Escherichia coli association association cdh1-ha17-1 10 20 unspecified role unspecified role unspecified role unspecified role Region 157-369 Region 157-369 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 21 unspecified role unspecified role unspecified role unspecified role Region 378-626 Region 378-626 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 23 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 25 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association ant-bota-1 1 24 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 22 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 21 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 23 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 25 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association ha17-ha70-1 17 23 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 21 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction ha70-ha17-1 19 21 unspecified role unspecified role bait bait Region 378-626 Region 378-626 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 23 unspecified role unspecified role prey prey ecolx Escherichia coli 25 unspecified role unspecified role prey prey ecolx Escherichia coli association association ha17-ha33-1 16 25 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 23 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction ha17-ha70-2 2 23 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 21 unspecified role unspecified role prey prey ecolx Escherichia coli physical association physical association cdh1-ha17-2 3 20 unspecified role unspecified role bait bait Region 157-369 Region 157-369 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli 21 unspecified role unspecified role prey prey ecolx Escherichia coli 23 unspecified role unspecified role prey prey ecolx Escherichia coli 25 unspecified role unspecified role prey prey ecolx Escherichia coli association association ant-ha70-1 11 22 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 21 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction ha70-cdh1-2 4 20 unspecified role unspecified role prey prey Region 157-369 Region 157-369 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P09803:p.Lys170Ser K170S mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain K S This feature has been corrected as a result of our quality control procedures. The original label was 'K170S'. Wed May 02 20:21:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys170ser' Tue Jun 30 20:02:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys170Ser' P09803:p.Lys175Met K175M mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain K M This feature has been corrected as a result of our quality control procedures. The original label was 'K175M'. Wed May 02 19:07:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys175met' Tue Jun 30 17:48:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys175Met' P09803:p.Asn176Arg N176R mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain N R This feature has been corrected as a result of our quality control procedures. The original label was 'N176R'. Wed May 02 14:44:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn176arg' Tue Jun 30 19:48:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn176Arg' P09803:p.Gln179Ala Q179A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Q A This feature has been corrected as a result of our quality control procedures. The original label was 'Q179A'. Wed May 02 17:37:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln179ala' Tue Jun 30 20:11:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln179Ala' ecolx Escherichia coli 21 unspecified role unspecified role bait bait Region 378-626 Region 378-626 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association ha17-ha33-2 13 21 unspecified role unspecified role unspecified role unspecified role Region 378-626 Region 378-626 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 23 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 25 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association ha17-ha33-3 7 25 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 23 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction ant-ha70-2 5 22 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 21 unspecified role unspecified role prey prey ecolx Escherichia coli physical association physical association cdh1-ha17-3 12 20 unspecified role unspecified role bait bait Region 157-369 Region 157-369 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli 21 unspecified role unspecified role prey prey ecolx Escherichia coli 23 unspecified role unspecified role prey prey ecolx Escherichia coli association association ha17-ha70-3 14 23 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 21 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction ant-ha70-3 18 22 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 21 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction ha70-cdh1-3 9 20 unspecified role unspecified role prey prey Region 157-369 Region 157-369 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 21 unspecified role unspecified role bait bait Region 378-626 Region 378-626 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range A5HZZ4:p.Arg505Ser R505S mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain R S This feature has been corrected as a result of our quality control procedures. The original label was 'R505S'. Wed May 02 19:53:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg505ser' Tue Jun 30 16:23:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg505Ser' ecolx Escherichia coli physical association physical association ha17-ha33-4 6 25 unspecified role unspecified role prey prey ecolx Escherichia coli 23 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association ant-ha17-1 15 22 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 21 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 23 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 25 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association