IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ A motif in LILRB2 critical for Angptl2 binding and activation. A motif in LILRB2 critical for Angptl2 binding and activation. Blood 2014 imex curation Deng M., Lu Z., Zheng J., Wan X., Chen X., Hirayasu K., Sun H., Lam Y., Chen L., Wang Q., Song C., Huang N., Gao GF., Jiang Y., Arase H., Zhang CC. I have not added any results for "multimers" - ("aggregate" ) in Figs 1E/F as this may be "crud". I have added fig 1D - though maybe this should be deleted? alec.zhang@utsouthwestern.edu, zhengjunke@sjtu.edu.cn 05-Sep-2017: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro facs fluorescence-activated cell sorting FACS Flow cytometry facs antibody detection identification by antibody antibody detection Deng M., Lu Z., Zheng J., Wan X., Chen X., Hirayasu K., Sun H., Lam Y., Chen L., Wang Q., Song C., Huang N., Gao GF., Jiang Y., Arase H., Zhang CC. I have not added any results for "multimers" - ("aggregate" ) in Figs 1E/F as this may be "crud". I have added fig 1D - though maybe this should be deleted? alec.zhang@utsouthwestern.edu, zhengjunke@sjtu.edu.cn Accepted 2017-AUG-09 AT 09:47 BST AT 09:47 BST by ORCHARD Blood 2014 imex curation A motif in LILRB2 critical for Angptl2 binding and activation. A motif in LILRB2 critical for Angptl2 binding and activation. Blood 2014 imex curation Deng M., Lu Z., Zheng J., Wan X., Chen X., Hirayasu K., Sun H., Lam Y., Chen L., Wang Q., Song C., Huang N., Gao GF., Jiang Y., Arase H., Zhang CC. I have not added any results for "multimers" - ("aggregate" ) in Figs 1E/F as this may be "crud". I have added fig 1D - though maybe this should be deleted? alec.zhang@utsouthwestern.edu, zhengjunke@sjtu.edu.cn 05-Sep-2017: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro electrophoresis electrophoretic mobility-based method electrophoresis predetermined predetermined participant predetermined Deng M., Lu Z., Zheng J., Wan X., Chen X., Hirayasu K., Sun H., Lam Y., Chen L., Wang Q., Song C., Huang N., Gao GF., Jiang Y., Arase H., Zhang CC. I have not added any results for "multimers" - ("aggregate" ) in Figs 1E/F as this may be "crud". I have added fig 1D - though maybe this should be deleted? alec.zhang@utsouthwestern.edu, zhengjunke@sjtu.edu.cn Accepted 2017-AUG-09 AT 09:47 BST AT 09:47 BST by ORCHARD Blood 2014 imex curation angl5_human Angiopoietin-related protein 5 ANGPTL5 UNQ5795/PRO19600 Angiopoietin-like protein 5 protein protein human Homo sapiens Human MMSPSQASLLFLNVCIFICGEAVQGNCVHHSTDSSVVNIVEDGSNAKDESKSNDTVCKEDCEESCDVKTKITREEKHFMCRNLQNSIVSYTRSTKKLLRNMMDEQQASLDYLSNQVNELMNRVLLLTTEVFRKQLDPFPHRPVQSHGLDCTDIKDTIGSVTKTPSGLYIIHPEGSSYPFEVMCDMDYRGGGRTVIQKRIDGIIDFQRLWCDYLDGFGDLLGEFWLGLKKIFYIVNQKNTSFMLYVALESEDDTLAYASYDNFWLEDETRFFKMHLGRYSGNAGDAFRGLKKEDNQNAMPFSTSDVDNDGCRPACLVNGQSVKSCSHLHNKTGWWFNECGLANLNGIHHFSGKLLATGIQWGTWTKNNSPVKIKSVSMKIRRMYNPYFK DIP protein Q86XS5 original sequence version: 64 4060C998885151BF hlag_human HLA class I histocompatibility antigen, alpha chain G HLAG HLA-G HLA-6.0 HLA G antigen MHC class I antigen G protein protein human Homo sapiens Human MVVMAPRTLFLLLSGALTLTETWAGSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD DIP protein P17693 original sequence version: 150 DIP protein P17693 original sequence version: 89 0678E263BE8962FF lirb2_human Leukocyte immunoglobulin-like receptor subfamily B member 2 LILRB2 ILT4 LIR2 MIR10 CD85 antigen-like family member D Immunoglobulin-like transcript 4 Monocyte/macrophage immunoglobulin-like receptor 10 protein protein human Homo sapiens Human MTPIVTVLICLGLSLGPRTHVQTGTIPKPTLWAEPDSVITQGSPVTLSCQGSLEAQEYRLYREKKSASWITRIRPELVKNGQFHIPSITWEHTGRYGCQYYSRARWSELSDPLVLVMTGAYPKPTLSAQPSPVVTSGGRVTLQCESQVAFGGFILCKEGEEEHPQCLNSQPHARGSSRAIFSVGPVSPNRRWSHRCYGYDLNSPYVWSSPSDLLELLVPGVSKKPSLSVQPGPVVAPGESLTLQCVSDVGYDRFVLYKEGERDLRQLPGRQPQAGLSQANFTLGPVSRSYGGQYRCYGAHNLSSECSAPSDPLDILITGQIRGTPFISVQPGPTVASGENVTLLCQSWRQFHTFLLTKAGAADAPLRLRSIHEYPKYQAEFPMSPVTSAHAGTYRCYGSLNSDPYLLSHPSEPLELVVSGPSMGSSPPPTGPISTPAGPEDQPLTPTGSDPQSGLGRHLGVVIGILVAVVLLLLLLLLLFLILRHRRQGKHWTSTQRKADFQHPAGAVGPEPTDRGLQWRSSPAADAQEENLYAAVKDTQPEDGVEMDTRAAASEAPQDVTYAQLHSLTLRRKATEPPPSQEREPPAEPSIYATLAIH DIP protein Q8N423 original sequence version: 127 DIP protein Q8N423 original sequence version: 104 33E9737AFCAFCE2D angl2_human Angiopoietin-related protein 2 ANGPTL2 ARP2 UNQ170/PRO196 Angiopoietin-like protein 2 protein protein human Homo sapiens Human MRPLCVTCWWLGLLAAMGAVAGQEDGFEGTEEGSPREFIYLNRYKRAGESQDKCTYTFIVPQQRVTGAICVNSKEPEVLLENRVHKQELELLNNELLKQKRQIETLQQLVEVDGGIVSEVKLLRKESRNMNSRVTQLYMQLLHEIIRKRDNALELSQLENRILNQTADMLQLASKYKDLEHKYQHLATLAHNQSEIIAQLEEHCQRVPSARPVPQPPPAAPPRVYQPPTYNRIINQISTNEIQSDQNLKVLPPPLPTMPTLTSLPSSTDKPSGPWRDCLQALEDGHDTSSIYLVKPENTNRLMQVWCDQRHDPGGWTVIQRRLDGSVNFFRNWETYKQGFGNIDGEYWLGLENIYWLTNQGNYKLLVTMEDWSGRKVFAEYASFRLEPESEYYKLRLGRYHGNAGDSFTWHNGKQFTTLDRDHDVYTGNCAHYQKGGWWYNACAHSNLNGVWYRGGHYRSRYQDGVYWAEFRGGSYSLKKVVMMIRPNPNTFH DIP protein Q9UKU9 original sequence version: 101 0F2ADECE53D185CA lilrb2-angptl2-2 1 6 unspecified role unspecified role prey prey conditioned medium conditioned medium c_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 5 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Q8N423:p.[His92_Gly97delinsSerAlaAspGluAlaArg;Gln99_Tyr100delinsArgGly] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain HTGRYG SADEAR certain certain sequence position certain certain certain sequence position certain QY RG Wed May 02 15:50:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his_thr_gly_arg_tyr_gly92-97ser_ala_asp_glu_ala_arg,gln_tyr99-100arg_gly' Tue Jun 30 16:28:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[His92_Gly97delinsSerAlaAspGluAlaArg;Gln99_Tyr100delinsArgGly]' Ig1+2_domains sufficient to bind sufficient binding region sufficient to bind range range range range Q8N423:p.His92Ser mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain H S Wed May 02 17:32:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his92ser' Tue Jun 30 16:00:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His92Ser' Q8N423:p.Thr93Ala mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain T A Wed May 02 19:32:04 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr93ala' Tue Jun 30 20:13:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr93Ala' Q8N423:p.Gly94Asp mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain G D Wed May 02 15:08:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly94asp' Tue Jun 30 18:55:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly94Asp' Q8N423:p.Arg95Glu mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain R E Wed May 02 19:51:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg95glu' Tue Jun 30 15:37:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg95Glu' Q8N423:p.Tyr96Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 16:53:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr96ala' Tue Jun 30 18:22:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr96Ala' Q8N423:p.Gly97Arg mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain G R Wed May 02 18:38:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly97arg' Tue Jun 30 18:21:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly97Arg' Q8N423:p.Tyr100Gly mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain Y G Wed May 02 17:38:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr100gly' Tue Jun 30 16:52:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr100Gly' Q8N423:p.Gly392Asp mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain G D Wed May 02 16:31:04 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly392asp' Tue Jun 30 19:49:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly392Asp' Q8N423:p.Thr393Glu mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain T E Wed May 02 16:45:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr393glu' Tue Jun 30 17:34:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr393Glu' Q8N423:p.Tyr394Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 14:47:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr394ala' Tue Jun 30 17:57:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr394Ala' Q8N423:p.[Tyr96Ala;Gly392Asp] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain Y A certain certain sequence position certain certain certain sequence position certain G D Wed May 02 15:56:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr96ala,gly392asp' Tue Jun 30 18:23:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Tyr96Ala;Gly392Asp]' Q8N423:p.[Tyr96Ala;Thr393Glu] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain Y A certain certain sequence position certain certain certain sequence position certain T E Wed May 02 18:19:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr96ala,thr393glu' Tue Jun 30 16:39:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Tyr96Ala;Thr393Glu]' Q8N423:p.[Tyr96Ala;Tyr394Ala] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain Y A certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 17:54:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr96ala,tyr394ala' Tue Jun 30 18:26:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Tyr96Ala;Tyr394Ala]' Q8N423:p.[Arg59Ala;Tyr61Ala] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 16:05:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg59ala,tyr61ala' Tue Jun 30 17:18:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg59Ala;Tyr61Ala]' Q8N423:p.[Trp90Ala;Asp200Ala;Asn202Ala;Tyr205Ala] mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain W A certain certain sequence position certain certain certain sequence position certain D A certain certain sequence position certain certain certain sequence position certain N A certain certain sequence position certain certain certain sequence position certain Y A Thu Aug 17 12:16:40 BST 2017 This feature has been corrected as a result of our quality control procedures. The original label was 'trp90ala,asp200ala,asn202ala,tyr205' Wed May 02 19:22:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp90ala,asp200ala,asn202ala,tyr205ala' Tue Jun 30 19:25:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Trp90Ala;Asp200Ala;Asn202Ala;Tyr205Ala]' Q8N423:p.Gln99Arg mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain Q R Wed May 02 18:17:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln99arg' Tue Jun 30 16:01:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln99Arg' Q8N423:p.[Arg59Ala;Tyr61Ala;Trp90Ala;Asp200Ala;Asn202Ala;Tyr205Ala] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain Y A certain certain sequence position certain certain certain sequence position certain W A certain certain sequence position certain certain certain sequence position certain D A certain certain sequence position certain certain certain sequence position certain N A certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 19:29:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg59ala,tyr61ala,trp90ala,asp200ala,asn202ala,tyr205ala' Tue Jun 30 18:53:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg59Ala;Tyr61Ala;Trp90Ala;Asp200Ala;Asn202Ala;Tyr205Ala]' human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association 1C, 3 A-G Angptl2 binds to LILRB2 with a significantly greater affinity than HLA-G LILRB2 Ig1 and Ig2 domains displayed about 50% of the maximal binding. I have not added mutations from Supp fig 5 as all are of "no effect" In parallel, we compared the binding of Angptl2/LILRB2 with HLA-G/LILRB2 using flow cytometry analysis. angptl2-angptl2-1 2 6 unspecified role unspecified role neutral component neutral component c_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range cc_domains sufficient to bind sufficient binding region sufficient to bind range range range range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 6 unspecified role unspecified role neutral component neutral component c_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range cc_domains sufficient to bind sufficient binding region sufficient to bind range range range range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association 1D The C terminal FBN domain only ran as a monomer. lilrb2-angptl2-3 1 4 unspecified role unspecified role prey prey conditioned medium conditioned medium c_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecd sufficient to bind sufficient binding region sufficient to bind range range range range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 5 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Q8N423:p.[Arg59Ala;Tyr61Ala] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 15:00:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg59ala,tyr61ala' Tue Jun 30 18:29:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg59Ala;Tyr61Ala]' Q8N423:p.His92Ser mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain H S Wed May 02 17:24:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his92ser' Tue Jun 30 16:20:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His92Ser' Q8N423:p.Thr93Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain T A Wed May 02 17:10:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr93ala' Tue Jun 30 17:39:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr93Ala' Q8N423:p.Gly94Asp mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain G D Wed May 02 15:22:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly94asp' Tue Jun 30 16:58:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly94Asp' Q8N423:p.Arg95Glu mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain R E Wed May 02 15:13:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg95glu' Tue Jun 30 16:33:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg95Glu' Q8N423:p.Tyr96Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 20:14:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr96ala' Tue Jun 30 16:26:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr96Ala' Q8N423:p.Gly97Arg mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain G R Wed May 02 14:34:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly97arg' Tue Jun 30 19:02:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly97Arg' Q8N423:p.Tyr100Gly mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain Y G Wed May 02 15:04:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr100gly' Tue Jun 30 18:41:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr100Gly' Q8N423:p.Gly392Asp mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain G D Wed May 02 20:04:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly392asp' Tue Jun 30 17:09:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly392Asp' Q8N423:p.Thr393Glu mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain T E Wed May 02 20:30:20 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr393glu' Tue Jun 30 15:41:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr393Glu' Q8N423:p.Tyr394Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 17:01:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr394ala' Tue Jun 30 19:52:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr394Ala' Q8N423:p.[Tyr96Ala;Gly392Asp] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain Y A certain certain sequence position certain certain certain sequence position certain G D Wed May 02 17:14:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr96ala,gly392asp' Tue Jun 30 19:16:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Tyr96Ala;Gly392Asp]' Q8N423:p.[Tyr96Ala;Thr393Glu] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain Y A certain certain sequence position certain certain certain sequence position certain T E Wed May 02 17:31:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr96ala,thr393glu' Tue Jun 30 16:05:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Tyr96Ala;Thr393Glu]' Q8N423:p.[Tyr96Ala;Tyr394Ala] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain Y A certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 14:41:20 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr96ala,tyr394ala' Tue Jun 30 19:21:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Tyr96Ala;Tyr394Ala]' Q8N423:p.[Arg59Ala;Tyr61Ala;Trp90Ala;Asp200Ala;Asn202Ala;Tyr205Ala] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain Y A certain certain sequence position certain certain certain sequence position certain W A certain certain sequence position certain certain certain sequence position certain D A certain certain sequence position certain certain certain sequence position certain N A certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 14:43:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg59ala,tyr61ala,trp90ala,asp200ala,asn202ala,tyr205ala' Tue Jun 30 17:46:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg59Ala;Tyr61Ala;Trp90Ala;Asp200Ala;Asn202Ala;Tyr205Ala]' Q8N423:p.[Trp90Ala;Asp200Ala;Asn202Ala;Tyr205Ala] mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain W A certain certain sequence position certain certain certain sequence position certain D A certain certain sequence position certain certain certain sequence position certain N A certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 18:33:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp90ala,asp200ala,asn202ala,tyr205ala' Tue Jun 30 17:01:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Trp90Ala;Asp200Ala;Asn202Ala;Tyr205Ala]' Q8N423:p.Gln99Arg mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain Q R Wed May 02 19:09:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln99arg' Tue Jun 30 17:51:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln99Arg' human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association 1C, 3G Angptl2 binds to LILRB2 with a significantly greater affinity than HLA-G lilrb2-hla_g-7 1 3 unspecified role unspecified role prey prey conditioned medium conditioned medium c_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 5 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Q8N423:p.[Arg59Ala;Tyr61Ala] mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 15:02:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg59ala,tyr61ala' Tue Jun 30 18:36:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg59Ala;Tyr61Ala]' Q8N423:p.His92Ser mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain H S Wed May 02 16:47:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his92ser' Tue Jun 30 16:45:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His92Ser' Q8N423:p.Thr93Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain T A Wed May 02 17:28:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr93ala' Tue Jun 30 19:13:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr93Ala' Q8N423:p.Gly94Asp mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain G D Wed May 02 17:07:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly94asp' Tue Jun 30 18:55:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly94Asp' Q8N423:p.Arg95Glu mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain R E Wed May 02 15:41:04 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg95glu' Tue Jun 30 18:43:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg95Glu' Q8N423:p.Tyr96Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 18:02:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr96ala' Tue Jun 30 19:12:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr96Ala' Q8N423:p.Gly97Arg mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain G R Wed May 02 17:42:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly97arg' Tue Jun 30 18:52:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly97Arg' Q8N423:p.Tyr100Gly mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain Y G Wed May 02 19:30:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr100gly' Tue Jun 30 17:12:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr100Gly' Q8N423:p.Gly392Asp mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain G D Wed May 02 18:33:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly392asp' Tue Jun 30 19:45:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly392Asp' Q8N423:p.Thr393Glu mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain T E Wed May 02 16:24:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr393glu' Tue Jun 30 18:06:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr393Glu' Q8N423:p.Tyr394Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 15:23:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr394ala' Tue Jun 30 18:22:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr394Ala' Q8N423:p.[Tyr96Ala;Gly392Asp] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain Y A certain certain sequence position certain certain certain sequence position certain G D Wed May 02 16:50:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr96ala,gly392asp' Tue Jun 30 16:34:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Tyr96Ala;Gly392Asp]' Q8N423:p.[Tyr96Ala;Thr393Glu] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain Y A certain certain sequence position certain certain certain sequence position certain T E Wed May 02 20:21:12 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr96ala,thr393glu' Tue Jun 30 18:03:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Tyr96Ala;Thr393Glu]' Q8N423:p.[Tyr96Ala;Tyr394Ala] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain Y A certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 19:59:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr96ala,tyr394ala' Tue Jun 30 15:41:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Tyr96Ala;Tyr394Ala]' Q8N423:p.[Arg59Ala;Tyr61Ala;Trp90Ala;Asp200Ala;Asn202Ala;Tyr205Ala] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain Y A certain certain sequence position certain certain certain sequence position certain W A certain certain sequence position certain certain certain sequence position certain D A certain certain sequence position certain certain certain sequence position certain N A certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 14:27:02 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg59ala,tyr61ala,trp90ala,asp200ala,asn202ala,tyr205ala' Tue Jun 30 15:45:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg59Ala;Tyr61Ala;Trp90Ala;Asp200Ala;Asn202Ala;Tyr205Ala]' Q8N423:p.[Trp90Ala;Asp200Ala;Asn202Ala;Tyr205Ala] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain W A certain certain sequence position certain certain certain sequence position certain D A certain certain sequence position certain certain certain sequence position certain N A certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 19:27:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp90ala,asp200ala,asn202ala,tyr205ala' Tue Jun 30 17:45:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Trp90Ala;Asp200Ala;Asn202Ala;Tyr205Ala]' Q8N423:p.Gln99Arg mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain Q R Wed May 02 18:49:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln99arg' Tue Jun 30 16:57:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln99Arg' human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association Supp fig 1B, 3G angptl2-angptl2-2 1 5 unspecified role unspecified role neutral component neutral component human-umbilical mononuclear cell human-umbilical mononuclear cell Human umbilical mononuclear cell umbilical mononuclear cell 6 unspecified role unspecified role neutral component neutral component conditioned medium conditioned medium c_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range cc_domains sufficient to bind sufficient binding region sufficient to bind range range range range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association supp Fig 6