DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu An asymmetric PAN3 dimer recruits a single PAN2 exonuclease to mediate mRNA deadenylation and decay. An asymmetric PAN3 dimer recruits a single PAN2 exonuclease to mediate mRNA deadenylation and decay. Nature structural & molecular biology 2014 imex curation Jonas S., Christie M., Peter D., Bhandari D., Loh B., Huntzinger E., Weichenrieder O., Izaurralde E. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Jonas S., Christie M., Peter D., Bhandari D., Loh B., Huntzinger E., Weichenrieder O., Izaurralde E. DIP original experiment: DIP-265608X Nature structural & molecular biology 2014 IMEx An asymmetric PAN3 dimer recruits a single PAN2 exonuclease to mediate mRNA deadenylation and decay. An asymmetric PAN3 dimer recruits a single PAN2 exonuclease to mediate mRNA deadenylation and decay. An asymmetric PAN3 dimer recruits a single PAN2 exonuclease to mediate mRNA deadenylation and decay. Nature structural & molecular biology 2014 imex curation Jonas S., Christie M., Peter D., Bhandari D., Loh B., Huntzinger E., Weichenrieder O., Izaurralde E. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Jonas S., Christie M., Peter D., Bhandari D., Loh B., Huntzinger E., Weichenrieder O., Izaurralde E. DIP original experiment: DIP-265616X Nature structural & molecular biology 2014 IMEx An asymmetric PAN3 dimer recruits a single PAN2 exonuclease to mediate mRNA deadenylation and decay. An asymmetric PAN3 dimer recruits a single PAN2 exonuclease to mediate mRNA deadenylation and decay. An asymmetric PAN3 dimer recruits a single PAN2 exonuclease to mediate mRNA deadenylation and decay. Nature structural & molecular biology 2014 imex curation Jonas S., Christie M., Peter D., Bhandari D., Loh B., Huntzinger E., Weichenrieder O., Izaurralde E. Only protein-protein interactions ecolx Escherichia coli sls static light scattering sls predetermined predetermined participant predetermined Jonas S., Christie M., Peter D., Bhandari D., Loh B., Huntzinger E., Weichenrieder O., Izaurralde E. DIP original experiment: DIP-265610X Nature structural & molecular biology 2014 IMEx An asymmetric PAN3 dimer recruits a single PAN2 exonuclease to mediate mRNA deadenylation and decay. An asymmetric PAN3 dimer recruits a single PAN2 exonuclease to mediate mRNA deadenylation and decay. An asymmetric PAN3 dimer recruits a single PAN2 exonuclease to mediate mRNA deadenylation and decay. Nature structural & molecular biology 2014 imex curation Jonas S., Christie M., Peter D., Bhandari D., Loh B., Huntzinger E., Weichenrieder O., Izaurralde E. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Jonas S., Christie M., Peter D., Bhandari D., Loh B., Huntzinger E., Weichenrieder O., Izaurralde E. DIP original experiment: DIP-265614X Nature structural & molecular biology 2014 IMEx An asymmetric PAN3 dimer recruits a single PAN2 exonuclease to mediate mRNA deadenylation and decay. An asymmetric PAN3 dimer recruits a single PAN2 exonuclease to mediate mRNA deadenylation and decay. An asymmetric PAN3 dimer recruits a single PAN2 exonuclease to mediate mRNA deadenylation and decay. Nature structural & molecular biology 2014 imex curation Jonas S., Christie M., Peter D., Bhandari D., Loh B., Huntzinger E., Weichenrieder O., Izaurralde E. Only protein-protein interactions drome Drosophila melanogaster (Fruit fly) Fruit fly anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Jonas S., Christie M., Peter D., Bhandari D., Loh B., Huntzinger E., Weichenrieder O., Izaurralde E. DIP original experiment: DIP-265617X Nature structural & molecular biology 2014 IMEx An asymmetric PAN3 dimer recruits a single PAN2 exonuclease to mediate mRNA deadenylation and decay. An asymmetric PAN3 dimer recruits a single PAN2 exonuclease to mediate mRNA deadenylation and decay. An asymmetric PAN3 dimer recruits a single PAN2 exonuclease to mediate mRNA deadenylation and decay. Nature structural & molecular biology 2014 imex curation Jonas S., Christie M., Peter D., Bhandari D., Loh B., Huntzinger E., Weichenrieder O., Izaurralde E. Only protein-protein interactions drome Drosophila melanogaster (Fruit fly) Fruit fly anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Jonas S., Christie M., Peter D., Bhandari D., Loh B., Huntzinger E., Weichenrieder O., Izaurralde E. DIP original experiment: DIP-265615X Nature structural & molecular biology 2014 IMEx An asymmetric PAN3 dimer recruits a single PAN2 exonuclease to mediate mRNA deadenylation and decay. An asymmetric PAN3 dimer recruits a single PAN2 exonuclease to mediate mRNA deadenylation and decay. An asymmetric PAN3 dimer recruits a single PAN2 exonuclease to mediate mRNA deadenylation and decay. Nature structural & molecular biology 2014 imex curation Jonas S., Christie M., Peter D., Bhandari D., Loh B., Huntzinger E., Weichenrieder O., Izaurralde E. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Jonas S., Christie M., Peter D., Bhandari D., Loh B., Huntzinger E., Weichenrieder O., Izaurralde E. DIP original experiment: DIP-265607X Nature structural & molecular biology 2014 IMEx An asymmetric PAN3 dimer recruits a single PAN2 exonuclease to mediate mRNA deadenylation and decay. An asymmetric PAN3 dimer recruits a single PAN2 exonuclease to mediate mRNA deadenylation and decay. An asymmetric PAN3 dimer recruits a single PAN2 exonuclease to mediate mRNA deadenylation and decay. Nature structural & molecular biology 2014 imex curation Jonas S., Christie M., Peter D., Bhandari D., Loh B., Huntzinger E., Weichenrieder O., Izaurralde E. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Jonas S., Christie M., Peter D., Bhandari D., Loh B., Huntzinger E., Weichenrieder O., Izaurralde E. DIP original experiment: DIP-265612X Nature structural & molecular biology 2014 IMEx An asymmetric PAN3 dimer recruits a single PAN2 exonuclease to mediate mRNA deadenylation and decay. An asymmetric PAN3 dimer recruits a single PAN2 exonuclease to mediate mRNA deadenylation and decay. An asymmetric PAN3 dimer recruits a single PAN2 exonuclease to mediate mRNA deadenylation and decay. Nature structural & molecular biology 2014 imex curation Jonas S., Christie M., Peter D., Bhandari D., Loh B., Huntzinger E., Weichenrieder O., Izaurralde E. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Jonas S., Christie M., Peter D., Bhandari D., Loh B., Huntzinger E., Weichenrieder O., Izaurralde E. DIP original experiment: DIP-265613X Nature structural & molecular biology 2014 IMEx An asymmetric PAN3 dimer recruits a single PAN2 exonuclease to mediate mRNA deadenylation and decay. An asymmetric PAN3 dimer recruits a single PAN2 exonuclease to mediate mRNA deadenylation and decay. An asymmetric PAN3 dimer recruits a single PAN2 exonuclease to mediate mRNA deadenylation and decay. Nature structural & molecular biology 2014 imex curation Jonas S., Christie M., Peter D., Bhandari D., Loh B., Huntzinger E., Weichenrieder O., Izaurralde E. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Jonas S., Christie M., Peter D., Bhandari D., Loh B., Huntzinger E., Weichenrieder O., Izaurralde E. DIP original experiment: DIP-265609X Nature structural & molecular biology 2014 IMEx An asymmetric PAN3 dimer recruits a single PAN2 exonuclease to mediate mRNA deadenylation and decay. An asymmetric PAN3 dimer recruits a single PAN2 exonuclease to mediate mRNA deadenylation and decay. An asymmetric PAN3 dimer recruits a single PAN2 exonuclease to mediate mRNA deadenylation and decay. Nature structural & molecular biology 2014 imex curation Jonas S., Christie M., Peter D., Bhandari D., Loh B., Huntzinger E., Weichenrieder O., Izaurralde E. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Jonas S., Christie M., Peter D., Bhandari D., Loh B., Huntzinger E., Weichenrieder O., Izaurralde E. DIP original experiment: DIP-265611X Nature structural & molecular biology 2014 IMEx An asymmetric PAN3 dimer recruits a single PAN2 exonuclease to mediate mRNA deadenylation and decay. pan3_drome PAN2-PAN3 deadenylation complex subunit PAN3 PAN3 PAB1P-dependent poly(A)-specific ribonuclease Poly(A)-nuclease deadenylation complex subunit 3 CG11486 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MCSTYGLLSFEFSDTAAMDPIFFSPTNGIPSESKLATYMNRQNVATPSGYGLNNGFSLLNLDSPLNKKSQVTPQSPEFIPTRLGSTPNFYAPYHNAPMQLSNGLNGVNGLTAAAAAAAAAAAAAAAAVPSSTSSASSASVTISKTANGGASMLALQKTASIASVTIAQQQPQHPQKQQQHPPSVGGGAVSAASAPIAISGAPPNPAAAPFVSSMSAQTPLKGRGAMMRQESPTAAMISGAGPGEKSPPHGMTPHGASPIPSALPTSVHQENVGGTIYFYPTANAQNSQPVVNSMVVDGTHPALHGVSAVAPMSAGVPAAMMYTGHVYPGPSSNVVTMQPKTLLESAFFMPDEMRAEVLARNEISNLIMDAAEAAQHALPLEVENYHALYPLEPPAQPLHAKLTFPATTYRATHNTTGYKYCLRRIHGFRLQSTKCMTLVEMWKKLQHTNVVQLREVFTTKAFGDNSLVLVYDYHPGSQTLLAKYFTPAPETNGYTDPFQGEARPFSHKSNMQRTSNGPLLPEATIWSIIMQLTAGLKAIHHAGLACKVLDPTKIIVTGKRVRFSSCCISDITQFDPNASNPLALVNMHQQDDLTALGRLVLALACRCLQSVQRDNVQSSIDMVTRNYSTDLRNFIVYLFTTNNRRSVTDLMPMIGARFYTQLDALQSKIDMQEDELAKEMENGRLYRILVKLNSINERPDFNLDCTWSETGDRYMLKLFRDYLFHSVTEDGRPWLDHAHIVQCLNKLDAGSIERVQLMSRDEQSVLIVSYAELKNCLENAFSELMSSAAN DIP protein Q95RR8 original sequence version: 119 19555B56DAA43E21 pan3_neucr PAN2-PAN3 deadenylation complex subunit pan3 par-2 PAB1P-dependent poly(A)-specific ribonuclease Poly(A)-nuclease deadenylation complex subunit 3 pan3 NCU01929 protein protein neucr Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) MAATRYNSGDLRRQVGSPRAKNRDTKETLCRNVVIYGHCRWEDSGCTFNHDQNKASVSQTDLNSNRRVFNVESPSFTPANQQQSAGKKSTFSSQAASAAPFTPRGVGTSTPTLQQANDSTIFNPAAIREFTPQNYDVGNTISQNGAQHVTQDGGLYSDPFSISSLGQTMPPQGQYNPYANDPNNLAGAGAGLYQPAGFGNGLVHPPNYHLYQPPSELYRPSLQPYQRTTYDFFIPKDRRENLQKKLFHMQQLLPNSGLPNLDRWHSLFPLDTKATRNSTCFGYPSWMYKAQNNKNGRHFALRRIEGYRLTNEKAILNVTKEWKKIINANIVTVHEAFTTEFFGDSSLIFVYDFHPLSETLYDHHFPPNNSHNRLRNTNKIPENLLWSYVCQIANALLAIHNAKLAARCLELSKIIWENNRIRLAACSILDVLHHDSPNRKTIEELQQEDFVKFGRIILALATNTPTLNFNNIDAALATIVPRYSTQLRGVLEWLIKPSAPGETKTVETLLGGITTHLANFANFVMQESDEKEFHLMRELENGRIARLMFKLSVVNERGDSCGVHNWSETGERLLLKLFRDYVFHQVDADGKARLDTNHYLNCLSKLDASSEEQILLTSRDNATVFVVSYRSIRQMLDRAYGELGKESKPSATGATI DIP protein Q7SDP4 original sequence version: 65 pan2_chatd PAN2-PAN3 deadenylation complex catalytic subunit PAN2 PAB1P-dependent poly(A)-specific ribonuclease Poly(A)-nuclease deadenylation complex subunit 2 CTHT_0042640 PAN2 protein protein chatd Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) MDADWDEVTRIAYPAPGTNDFPRPATAVAFDPIAELLWAGFDRGRVCSFYGRDLTRYTAFKIQPASEGPVRQFLFHDKGVIVLGTRSVHMAMRRGPALWNIRHENMKDLRCMSFTSKGTQEIIVAGWQDTMLVIDVLKGDIIKQIPAQHHYSIMKKSRYICAATKTGSVDLIDPLSFKIVRSWQAHASYINDMDAQNDFIVTCGGSLKQQAAQTYMLDPYVNVFDLKNMASMKPMPFPPLAAHVRLHPRMLTTAIVTSQHGQMHVVDIMNPNSSTVRYANISSYVKLFEIAPSGEALVIGDADCNIHLWGSPTKIHFTDMAIPIELPEPEEPAPVLDWSIETPLSSIGLPYYREPLFSAWPADIISDVGAPPLQLEPSFVATLKQAEWGLYGKNTRNVRRNQVEDTRNTNKQSNALQAPKFLSERARESALSSGGDSSSDPQVDQEPEDPNEIESLKPEAPPLYRNLEIKYSKFGVDDFDFGYYNKTRYAGLENHIPNSYANSLLQLMHYTPLLRNMALQHAATACVSDLCLLCELGFVFDMLQKAEGATCQATNMFKALSGTPQAAPLGLLEEETHVPSLATMAQNLSRFLLEKIHNEYRTIPPISTALEQSLFNFPHPPTPDELVAKVLATSAVATIKCMNCRSETTRPGTTHVIDLLYPPPKTAGRGGRASKVTFSQVLKMGVERETTSKGWCSRCQRYQNLQMRKTIHSVPAVLVVNAGVSNQEHRKLWSTPGWLPEEIGIIVDQGQFFCFEGEDLKLHLQRGIHNITVYSLIGMVINIESHSPQKSHLVGIINVAHAEATPPGENKWHLFNDFSVRPVSAAEALTFNAAWKMPAVLLFQIKSANNKSNLDWKTNLDTSILYKDTNPNTEKKTYRTLDQERERPGPDTIVALDTEFVSLKQPEIQMNSDGERETIRPMSHALARVSVVRGQGENEGSAFIDDYIAIREPVVDYLTLYSGITASDLDPRTSKHNLVSLKTAYKKLWVLLNLGCKFLGHGLKQDFRVINIQVPRAQVIDTIEVFYLKSRLRKLSLAFLAWYLLKEDIQLETHDSIEDARTALKLYRKYLEFDDAGILEAMLEDIYKAGRATNFKPPRREDREKELQRQSTPPNSTAPNDCGAKPDGNGNENGGEPATPARKTGGITAPTFGAVNVFGTPSKASSPLPK DIP protein G0SAK8 original sequence version: 16 15A0AC212FBA37F8 pan3_chatd PAN2-PAN3 deadenylation complex subunit PAN3 Poly(A)-nuclease deadenylation complex subunit 3 CTHT_0011660 PAN3 PAB1P-dependent poly(A)-specific ribonuclease protein protein chatd Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) MAPLDLTRGQTDACSTENKDILCRNVLIYGHCRYEDQGCTYNHDQNKNSSQPEAPSKKMFNVDSPSFTPSGQSTVLPKKTTLSSQAASAAPFTPRGGGTPTLQTTAESTMFNPAAIREFTPQNYDLGNNNANGISQENGLYPDPFTMSTMGTALPTAGQYNLPLYGDHSGLAAPGAPFYPPHAAYPTGPIQPPHYHLYQPFGPYRQELQPWQRATYDFFMPQNLREDLQKKQFATLQVIPNSGLPQLEHWHSLVPLDTSNRKNTSCFGYPSWVYKAQNSRNGRHYALRRLEGYRLTNEKAILNVMKDWKKIKNASIVTIHEVFTTREFGDSSLIFAYDFHPLSKTLQEHHFQPIHGNRYRPPPAVPENTIWGYICQIANALKTIHSNRLAARCLEPSKIILTDINRIRLSACAILDVVQFGMNSRSVVELQQEDFVKFGKLILSLATGTLPAHLNNIPAALETLGNKYSANLKSAVNWLLDTSSGETKTIEHFMTGIASQMTTFFDLALQDNDEKLFHLAREVENGRIARSLMKLLTILERGDYDGVPSWSETGDRYQLKLFRDYVFHRVDADGKPNLSIGHMLTCMSKLEAGVDENILLTSRDNETVFVLSYRELRQMYDRAFNELVKASKTGAPGANT ABE58EFE0C199D61 pan2_drome PAN2-PAN3 deadenylation complex catalytic subunit PAN2 PAN2 PAB1P-dependent poly(A)-specific ribonuclease Poly(A)-nuclease deadenylation complex subunit 2 CG8232 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MDYVYCGTDPIGASEDILSVYDAGSAPGNGHFSPSFNGFNIGTTDPEYVELVPVLADGGEHFGVSSVAFDDYEELLWMGNQGGHVTSYYTNSMQKYTSFQVHATDIVRDISTLDSGVLALTQTSLRHQIRRGLPKFTFKSNNMKEMVSMLQLSPHRLVMAGLQDELIDFDLRTLKETRIEHVGAGGCTVLRKNSRYLFAGDQLGTVTLRDLNSLSVQHTIKTHTNILSDFSVQGNLLISCGYSGRQNNLAIDRFLMVYDLRMLRLIAPIQVMIDPQMLKFLPSLTSQLAVVSSYGQVQLVDTVELSEPRVSMYQINTNGSQCLSFDISSSSQAMAFGDQSGHINMIAAVQTPQPQFNLYSRSTEFADVVPQLPMVSITDTNFPLSSVMLPHLTTGTQWFSDWPEELLRYRYHRPKTIDPEVLSNMKMQGPIGYSPNPRTARRNQIPYVIEQGGVCSPNGNGTAAATKAENGVKIIPRRYRKVELKYTKLGTQDFDFDQHNQTCFAGLEATLPNSYCNAMLQILYFTDALRVKLLEHSCIKEFCLSCELGFLFNMLDKSTASSPCQASNFLRSFRTVPEASALGLILTDRSSNVNLISLIQNWNRFILHQMHYEIFDSSKNASTYSGSVQTSTNAENAGSSETSGSSDLYDSISDENSKEDDRERSKINAETDISKIFGTKQICINRCIKCQEEKIKESILLACNLSYPNHIKDSDQYFNFGTILKRSLSSEKSIQAFCERCKKFSPTNQSVKVTSLPQILSINCGLNNEKDITFLKRQLNRCSEKTTVDAAASLSTSKPCRYGANCSRSDCHFMHPDRKSPSHTSQPNAVNNSPNGRQKSWFPLTFTMGINDQGEVQVQTQSDASSGKSEQEEETEKPPTKGLDNNRMYALHAVVCQVDDGTQKNLVSLINVQRPYHTMKLAESADDPQSQWYIFNDFSISPVSPQESVWFTLDWKVPCILFYRHVEDDSESASTTSSTVTESEETIPSESSSGSPTNLSNPFLEEIVSPMLGNLSADATLQPLQSDEMPQSGDLVAMDAEFVTLNPEENEIRPDGKTATIKPCHMSVARISCIRGQGPAEGVPFMDDYISTQEKVVDYLTQFSGIKPGDLDANFSKKRLTALKYSYQKLKYLVDVGVIFVGHGLKNDFRVINIYVPSEQIIDTVHLFHMPHHRMVSLRFLAWHFLGTKIQSETHDSIEDARTTLQLYKHYLKLQEEKKFANALKNLYERGKQLQWKVPED DIP protein A1Z7K9 original sequence version: 76 BFFE4AB585B1FB5D pan3_human PAN2-PAN3 deadenylation complex subunit PAN3 PAN3 PAB1P-dependent poly(A)-specific ribonuclease Poly(A)-nuclease deadenylation complex subunit 3 protein protein human Homo sapiens Human MNSGGGLPPPSAAASPSSSSLAAAVAVVAPPGVGGVPGGAAVGVKLKYCRYYAKDKTCFYGEECQFLHEDPAAGAAPGLGLHSNSVPLALAGAPVAGFPPGAVAGGGAGPPPGPKKPDLGDPGTGAAAGGGGSSGGLDGPRLAIPGMDGGALTDTSLTDSYFSTSFIGVNGFGSPVETKYPLMQRMTNSSSSPSLLNDSAKPYSAHDPLTSPASSLFNDFGALNISQRRKPRKYRLGMLEERLVPMGSKARKAKNPIGCLADRCKSGVPINMVWWNRVTENNLQTPNPTASEFIPKGGSTSRLSNVSQSNMSAFSQVFSHPSMGSPATAGLAPGMSLSAGSSPLHSPKITPHTSPAPRRRSHTPNPASYMVPSSASTSVNNPVSQTPSSGQVIQKETVGGTTYFYTDTTPAPLTGMVFPNYHIYPPTAPHVAYMQPKANAPSFFMADELRQELINRHLITMAQIDQADMPAVPTEVDSYHSLFPLEPLPPPNRIQKSSNFGYITSCYKAVNSKDDLPYCLRRIHGFRLVNTKCMVLVDMWKKIQHSNIVTLREVFTTKAFAEPSLVFAYDFHAGGETMMSRHFNDPNADAYFTKRKWGQHEGPLPRQHAGLLPESLIWAYIVQLSSALRTIHTAGLACRVMDPTKILITGKTRLRVNCVGVFDVLTFDNSQNNNPLALMAQYQQADLISLGKVVLALACNSLAGIQRENLQKAMELVTINYSSDLKNLILYLLTDQNRMRSVNDIMPMIGARFYTQLDAAQMRNDVIEEDLAKEVQNGRLFRLLAKLGTINERPEFQKDPTWSETGDRYLLKLFRDHLFHQVTEAGAPWIDLSHIISCLNKLDAGVPEKISLISRDEKSVLVVTYSDLKRCFENTFQELIAAANGQL DIP protein Q58A45 original sequence version: 90 4883F859D2A642D2 q504q3-2 PAN2-PAN3 deadenylation complex catalytic subunit PAN2 PAN2 Inactive ubiquitin carboxyl-terminal hydrolase 52 KIAA0710 USP52 PAB1P-dependent poly(A)-specific ribonuclease Poly(A)-nuclease deadenylation complex subunit 2 protein protein human Homo sapiens Human MNFEGLDPGLAEYAPAMHSALDPVLDAHLNPSLLQNVELDPEGVALEALPVQESVHIMEGVYSELHSVVAEVGVPVSVSHFDLHEEMLWVGSHGGHATSFFGPALERYSSFQVNGSDDIRQIQSLENGILFLTKNNLKYMARGGLIIFDYLLDENEDMHSLLLTDSSTLLVGGLQNHIIEIDLNTVQETQKYAVETPGVTIMRQTNRFFFCGHTSGKVSLRDLRTFKVEHEFDAFSGSLSDFDVHGNLLAACGFSSRLTGLACDRFLKVYDLRMMRAITPLQVHVDPAFLRFIPTYTSRLAIISQSGQCQFCEPTGLANPADIFHVNPVGPLLMTFDVSASKQALAFGDSEGCVHLWTDSPEPSFNPYSRETEFALPCLVDSLPPLDWSQDLLPLSLIPVPLTTDTLLSDWPAANSAPAPRRAPPVDAEILRTMKKVGFIGYAPNPRTRLRNQIPYRLKESDSEFDSFSQVTESPVGREEEPHLHMVSKKYRKVTIKYSKLGLEDFDFKHYNKTLFAGLEPHIPNAYCNCMIQVLYFLEPVRCLIQNHLCQKEFCLACELGFLFHMLDLSRGDPCQGNNFLRAFRTIPEASALGLILADSDEASGKGNLARLIQRWNRFILTQLHQDMQELEIPQAYRGAGGSSFCSSGDSVIGQLFSCEMENCSLCRCGSETVRASSTLLFTLSYPDDKTGKNYDFAQVLKRSICLDQNTQAWCDTCEKYQPTIQTRNIRHLPDILVINCEVNSSKEADFWRMQAEVAFKMAVKKHGGEISKNKEFALADWKELGSPEGVLVCPSIEELKNVWLPFSIRMKMTKNKGLDVCNWTDGDEMQWGPARAEEEHGVYVYDLMATVVHILDSRTGGSLVAHIKVGETYHQRKEGVTHQQWYLFNDFLIEPIDKHEAVQFDMNWKVPAILYYVKRNLNSRYNLNIKNPIEASVLLAEASLARKQRKTHTTFIPLMLNEMPQIGDLVGLDAEFVTLNEEEAELRSDGTKSTIKPSQMSVARITCVRGQGPNEGIPFIDDYISTQEQVVDYLTQYSGIKPGDLDAKISSKHLTTLKSTYLKLRFLIDIGVKFVGHGLQKDFRVINLMVPKDQVLDTVYLFHMPRKRMISLRFLAWYFLDLKIQGETHDSIEDARTALQLYRKYLELSKNGTEPESFHKVLKGLYEKGRKMDWKVPEPEGQTSPKNAAVFSSVLAL pan2_neucr PAN2-PAN3 deadenylation complex catalytic subunit pan2 par-1 PAB1P-dependent poly(A)-specific ribonuclease Poly(A)-nuclease deadenylation complex subunit 2 pan2 NCU04792 NCU10733 protein protein neucr Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) MDSRDWTQLGCVAYPSPIHPDYHAGPASTIAFDNQDELLWIGTQKGFAGSFIGRELKRFTAFRIHPETDGPLRQFLFVDKGVIFLGSRSVYMAARSGVPIWSIRHESMQDLRAMSFTSKGTSEILVAGWQNKMLVIDVNKGEVVKELPTQDQYSFLKMSRYICAATNKGTVNILDPITFTIKKQWQAHGAFINDLDTSNDFIVTCGGSHRQTHNTPAILDPYVKVFDLKNMSAMNPVPFAPLAAHVRMHPRMLTTAIVVNQAGQIHVTDLLNPSNSQVCYTQPQGVVLHFDVSRTGEGKALADNKHNTYVWGSPNKIQFTEIGIPPRLPDPPQPSLLPPDPDMLEELPLSRIGLPYYREQLFSALPPDIISDVGAPPQQIDPNILSTLTKTDWGYIGPNKTGLQRNQYMDTRSTMKTSNTIRAPKFLSEKARESQTGSEDNTLATNETAMMTPNNDHWSLRPEAPPEYRICEIKYSKFGVDDFDFGFFNNTPYPGLENNITNSYANSLLQVMHYTPLLRNMALQHAATACLADPCLLCELGYVFDMLQKGEGPSCHATNMLRALNHTSNASVSGVLEDIAKDKNPSTLVKNLTMFLFDKISQDYKGTPPISTELERTLFKLNQPPNPLDLVKRLLETDARYQIKCMHCQHVSPRTATTFVNKLCYPAAKPNIRGMKAQRITFSQVLKAGLENEAVNKGYCTKCQRYQNLDQRKIIFNIPAVLALCTEITTAEHRKLWSTPGWLPEEIGIIVDQGHVYCYEGDDLKLHLNRGIHNITVYSLVGTVVNVETKSPQKSHLVATVNVGRAEPESKDQDRWHLFNDFSVRGISKVEALTFNAAWKMPVVVMFQVKAANHRFNMDWKTRLDTSVLFRDNNPHALKTYELLDRETEIPGPDTVIAIDTEFIRLKEREIHIDEDGKSKTIRPISHAIARASVVRGQGSREGVAFIDDYIHIKETIVDYLTEWSGITPTDLDPINSQRNLVSPKTAYKKLWVLVNLGCKFLGHGLSQDFRVINIQVPRNQVIDTSIIFMKPPSQRKISLAFLAWYLLKEDIQQNTHDSIEDAQTALKLYRKYEEFMANGSFHDVLEALYKKGKTLNFKPPRISTGAAKDAGFGAVHRVGTPPVPAPGTTEGSFEISNSSTATTGGSALSATGGMGSASASSSMPSTPVRKPIGLGGPFTVAGVVKPSPATSLDNFGAGAVGTGITTAAATMGGGYGGYGTDGAYWGGPNDMAPTSMIGGSAFIPAKFPPGPPETRGFIPYRPQVLLAEREAAAAAAAAAAAAAANNDVGGRGGVACGNGGAGGEQGKQE DIP protein P0C581 original sequence version: 51 pan2-pan3-2 10 13 unspecified role unspecified role unspecified role unspecified role Region 538-656 Region 538-656 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 19 unspecified role unspecified role unspecified role unspecified role Region 1-321 Region 1-321 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction g0s0y3_chatd-pan2-1 7 15 unspecified role unspecified role unspecified role unspecified role Region 448-555 Region 448-555 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 14 unspecified role unspecified role unspecified role unspecified role Region 1-457 Region 1-457 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction pan2-pan3-7 2 13 unspecified role unspecified role prey prey Region 234-656 Region 234-656 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q7SDP4:p.Val627Glu V627E mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain V E This feature has been corrected as a result of our quality control procedures. The original label was 'V627E'. Wed May 02 18:32:20 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val627glu' Tue Jun 30 17:56:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val627Glu' ecolx Escherichia coli 19 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Region 1-321 Region 1-321 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association pan2-pan3-8 9 17 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 18 unspecified role unspecified role bait bait Region 1-433 Region 1-433 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human physical association physical association pan2-pan3-9 11 13 unspecified role unspecified role unspecified role unspecified role Region 538-656 Region 538-656 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 19 unspecified role unspecified role unspecified role unspecified role Region 1-321 Region 1-321 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction pan2-pan3-10 3 13 unspecified role unspecified role unspecified role unspecified role Region 538-656 Region 538-656 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 19 unspecified role unspecified role unspecified role unspecified role Region 1-321 Region 1-321 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction g0s0y3_chatd-pan2-2 1 15 unspecified role unspecified role unspecified role unspecified role Region 448-555 Region 448-555 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 14 unspecified role unspecified role unspecified role unspecified role Region 1-457 Region 1-457 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction pan2-pan3-11 4 13 unspecified role unspecified role prey prey Region 234-656 Region 234-656 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 19 unspecified role unspecified role bait bait Region 1-321 Region 1-321 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P0C581:p.Phe62Glu F62E mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain F E This feature has been corrected as a result of our quality control procedures. The original label was 'F62E'. Wed May 02 17:00:20 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe62glu' Tue Jun 30 20:06:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe62Glu' P0C581:p.Gly97Glu G97E mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain G E This feature has been corrected as a result of our quality control procedures. The original label was 'G97E'. Wed May 02 16:25:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly97glu' Tue Jun 30 16:53:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly97Glu' P0C581:p.Thr60Arg T60R mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain T R This feature has been corrected as a result of our quality control procedures. The original label was 'T60R'. Wed May 02 19:18:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr60arg' Tue Jun 30 18:14:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr60Arg' P0C581:p.Pro99Arg P99R mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain P R This feature has been corrected as a result of our quality control procedures. The original label was 'P99R'. Wed May 02 18:07:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro99arg' Tue Jun 30 16:05:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro99Arg' ecolx Escherichia coli physical association physical association pan3_drome-pan2-1 5 12 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q95RR8:p.[Trp707Ala;Gly711Glu;Tyr722Ala;His739Ala;Arg754Ala] Y722A/H739A/R754A/W707A/G711E mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain H A certain certain sequence position certain certain certain sequence position certain Y A certain certain sequence position certain certain certain sequence position certain G E certain certain sequence position certain certain certain sequence position certain W A This feature has been corrected as a result of our quality control procedures. The original label was 'Y722A/H739A/R754A/W707A/G711E'. Wed May 02 17:44:35 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp707ala,gly711glu,tyr722ala,his739ala,arg754ala' Tue Jun 30 18:50:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Trp707Ala;Gly711Glu;Tyr722Ala;His739Ala;Arg754Ala]' Q95RR8:p.[Tyr722Ala;His739Ala;Arg754Ala] Y722A/H739A/R754A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain H A certain certain sequence position certain certain certain sequence position certain Y A This feature has been corrected as a result of our quality control procedures. The original label was 'Y722A/H739A/R754A'. Wed May 02 17:38:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr722ala,his739ala,arg754ala' Tue Jun 30 19:55:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Tyr722Ala;His739Ala;Arg754Ala]' drome Drosophila melanogaster (Fruit fly) Fruit fly 16 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range drome Drosophila melanogaster (Fruit fly) Fruit fly physical association physical association pan2-pan3-12 8 13 unspecified role unspecified role unspecified role unspecified role Region 234-656 Region 234-656 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 19 unspecified role unspecified role unspecified role unspecified role Region 1-351 Region 1-351 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction pan2-pan3_drome-1 6 12 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range drome Drosophila melanogaster (Fruit fly) Fruit fly 16 unspecified role unspecified role bait bait Region 1-468 Region 1-468 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Region 1-376 Region 1-376 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Region 358-467 Region 358-467 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range A1Z7K9:p.[Thr97Arg;His102Gly] T97R/H102G mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain T R certain certain sequence position certain certain certain sequence position certain H G This feature has been corrected as a result of our quality control procedures. The original label was 'T97R/H102G'. Wed May 02 15:13:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr97arg,his102gly' Tue Jun 30 19:58:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Thr97Arg;His102Gly]' drome Drosophila melanogaster (Fruit fly) Fruit fly physical association physical association