DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu ANCHR mediates Aurora-B-dependent abscission checkpoint control through retention of VPS4. ANCHR mediates Aurora-B-dependent abscission checkpoint control through retention of VPS4. Nature cell biology 2014 imex curation Thoresen SB., Campsteijn C., Vietri M., Schink KO., Liestøl K., Andersen JS., Raiborg C., Stenmark H. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Thoresen SB., Campsteijn C., Vietri M., Schink KO., Liestøl K., Andersen JS., Raiborg C., Stenmark H. DIP original experiment: DIP-260972X Nature cell biology 2014 IMEx ANCHR mediates Aurora-B-dependent abscission checkpoint control through retention of VPS4. ANCHR mediates Aurora-B-dependent abscission checkpoint control through retention of VPS4. ANCHR mediates Aurora-B-dependent abscission checkpoint control through retention of VPS4. Nature cell biology 2014 imex curation Thoresen SB., Campsteijn C., Vietri M., Schink KO., Liestøl K., Andersen JS., Raiborg C., Stenmark H. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Thoresen SB., Campsteijn C., Vietri M., Schink KO., Liestøl K., Andersen JS., Raiborg C., Stenmark H. DIP original experiment: DIP-260974X Nature cell biology 2014 IMEx ANCHR mediates Aurora-B-dependent abscission checkpoint control through retention of VPS4. ANCHR mediates Aurora-B-dependent abscission checkpoint control through retention of VPS4. ANCHR mediates Aurora-B-dependent abscission checkpoint control through retention of VPS4. Nature cell biology 2014 imex curation Thoresen SB., Campsteijn C., Vietri M., Schink KO., Liestøl K., Andersen JS., Raiborg C., Stenmark H. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Thoresen SB., Campsteijn C., Vietri M., Schink KO., Liestøl K., Andersen JS., Raiborg C., Stenmark H. DIP original experiment: DIP-260973X Nature cell biology 2014 IMEx ANCHR mediates Aurora-B-dependent abscission checkpoint control through retention of VPS4. ANCHR mediates Aurora-B-dependent abscission checkpoint control through retention of VPS4. ANCHR mediates Aurora-B-dependent abscission checkpoint control through retention of VPS4. Nature cell biology 2014 imex curation Thoresen SB., Campsteijn C., Vietri M., Schink KO., Liestøl K., Andersen JS., Raiborg C., Stenmark H. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Thoresen SB., Campsteijn C., Vietri M., Schink KO., Liestøl K., Andersen JS., Raiborg C., Stenmark H. DIP original experiment: DIP-260971X Nature cell biology 2014 IMEx ANCHR mediates Aurora-B-dependent abscission checkpoint control through retention of VPS4. ANCHR mediates Aurora-B-dependent abscission checkpoint control through retention of VPS4. ANCHR mediates Aurora-B-dependent abscission checkpoint control through retention of VPS4. Nature cell biology 2014 imex curation Thoresen SB., Campsteijn C., Vietri M., Schink KO., Liestøl K., Andersen JS., Raiborg C., Stenmark H. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence Thoresen SB., Campsteijn C., Vietri M., Schink KO., Liestøl K., Andersen JS., Raiborg C., Stenmark H. DIP original experiment: DIP-260970X Nature cell biology 2014 IMEx ANCHR mediates Aurora-B-dependent abscission checkpoint control through retention of VPS4. chm4c_human Charged multivesicular body protein 4c CHMP4C SHAX3 Chromatin-modifying protein 4c Vacuolar protein sorting-associated protein 32-3 SNF7-3 SNF7 homolog associated with Alix 3 protein protein human Homo sapiens Human MSKLGKFFKGGGSSKSRAAPSPQEALVRLRETEEMLGKKQEYLENRIQREIALAKKHGTQNKRAALQALKRKKRFEKQLTQIDGTLSTIEFQREALENSHTNTEVLRNMGFAAKAMKSVHENMDLNKIDDLMQEITEQQDIAQEISEAFSQRVGFGDDFDEDELMAELEELEQEELNKKMTNIRLPNVPSSSLPAQPNRKPGMSSTARRSRAASSQRAEEEDDDIKQLAAWAT DIP protein Q96CF2 original sequence version: 46 DIP protein Q96CF2 original sequence version: 102 DIP protein Q96CF2 original sequence version: 82 C18050F0A6C4C899 q96k21-1 Abscission/NoCut checkpoint regulator ZFYVE19 ANCHR MPFYVE MLL partner containing FYVE domain Zinc finger FYVE domain-containing protein 19 protein protein human Homo sapiens Human MNYDSQQPPLPPLPYAGCRRASGFPALGRGGTVPVGVWGGAGQGREGRSWGEGPRGPGLGRRDLSSADPAVLGATMESRCYGCAVKFTLFKKEYGCKNCGRAFCSGCLSFSAAVPRTGNTQQKVCKQCHEVLTRGSSANASKWSPPQNYKKRVAALEAKQKPSTSQSQGLTRQDQMIAERLARLRQENKPKLVPSQAEIEARLAALKDERQGSIPSTQEMEARLAALQGRVLPSQTPQPAHHTPDTRTQAQQTQDLLTQLAAEVAIDESWKGGGPAASLQNDLNQGGPGSTNSKRQANWSLEEEKSRLLAEAALELREENTRQERILALAKRLAMLRGQDPERVTLQDYRLPDSDDDEDEETAIQRVLQQLTEEASLDEASGFNIPAEQASRPWTQPRGAEPEAQDVDPRPEAEEEELPWCCICNEDATLRCAGCDGDLFCARCFREGHDAFELKEHQTSAYSPPRAGQEH DIP protein Q96K21-1 original sequence version: 107 vps4a_human Vacuolar protein sorting-associated protein 4A VPS4-1 Protein SKD2 VPS4A VPS4 protein protein human Homo sapiens Human MTTSTLQKAIDLVTKATEEDKAKNYEEALRLYQHAVEYFLHAIKYEAHSDKAKESIRAKCVQYLDRAEKLKDYLRSKEKHGKKPVKENQSEGKGSDSDSEGDNPEKKKLQEQLMGAVVMEKPNIRWNDVAGLEGAKEALKEAVILPIKFPHLFTGKRTPWRGILLFGPPGTGKSYLAKAVATEANNSTFFSVSSSDLMSKWLGESEKLVKNLFELARQHKPSIIFIDEVDSLCGSRNENESEAARRIKTEFLVQMQGVGNNNDGTLVLGATNIPWVLDSAIRRRFEKRIYIPLPEEAARAQMFRLHLGSTPHNLTDANIHELARKTEGYSGADISIIVRDSLMQPVRKVQSATHFKKVCGPSRTNPSMMIDDLLTPCSPGDPGAMEMTWMDVPGDKLLEPVVCMSDMLRSLATTRPTVNADDLLKVKKFSEDFGQES DIP protein Q9UN37 original sequence version: 134 DIP protein Q9UN37 original sequence version: 116 DIP protein Q9UN37 original sequence version: 127 C3CC556FB84F105C zfyve19-vps4a-1 5 8 unspecified role unspecified role prey prey human Homo sapiens Human 7 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human physical association physical association zfyve19-vps4a-2 1 8 unspecified role unspecified role prey prey Region 1-80 Region 1-80 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain V5-tag V5-tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 7 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human physical association physical association chmp4c-vps4a-1 2 6 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 8 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association zfyve19-vps4a-3 4 8 unspecified role unspecified role prey prey human Homo sapiens Human 7 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Region 172-185 Region 172-185 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human physical association physical association zfyve19-chmp4c-1 3 6 unspecified role unspecified role prey prey V5-tag V5-tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 7 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human physical association physical association