DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structural basis of starvation-induced assembly of the autophagy initiation complex. Structural basis of starvation-induced assembly of the autophagy initiation complex. Nature structural & molecular biology 2014 imex curation Fujioka Y., Suzuki SW., Yamamoto H., Kondo-Kakuta C., Kimura Y., Hirano H., Akada R., Inagaki F., Ohsumi Y., Noda NN. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Fujioka Y., Suzuki SW., Yamamoto H., Kondo-Kakuta C., Kimura Y., Hirano H., Akada R., Inagaki F., Ohsumi Y., Noda NN. DIP original experiment: DIP-260897X Nature structural & molecular biology 2014 IMEx Structural basis of starvation-induced assembly of the autophagy initiation complex. Structural basis of starvation-induced assembly of the autophagy initiation complex. Structural basis of starvation-induced assembly of the autophagy initiation complex. Nature structural & molecular biology 2014 imex curation Fujioka Y., Suzuki SW., Yamamoto H., Kondo-Kakuta C., Kimura Y., Hirano H., Akada R., Inagaki F., Ohsumi Y., Noda NN. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Fujioka Y., Suzuki SW., Yamamoto H., Kondo-Kakuta C., Kimura Y., Hirano H., Akada R., Inagaki F., Ohsumi Y., Noda NN. DIP original experiment: DIP-260902X Nature structural & molecular biology 2014 IMEx Structural basis of starvation-induced assembly of the autophagy initiation complex. Structural basis of starvation-induced assembly of the autophagy initiation complex. Structural basis of starvation-induced assembly of the autophagy initiation complex. Nature structural & molecular biology 2014 imex curation Fujioka Y., Suzuki SW., Yamamoto H., Kondo-Kakuta C., Kimura Y., Hirano H., Akada R., Inagaki F., Ohsumi Y., Noda NN. Only protein-protein interactions ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Fujioka Y., Suzuki SW., Yamamoto H., Kondo-Kakuta C., Kimura Y., Hirano H., Akada R., Inagaki F., Ohsumi Y., Noda NN. DIP original experiment: DIP-260911X Nature structural & molecular biology 2014 IMEx Structural basis of starvation-induced assembly of the autophagy initiation complex. Structural basis of starvation-induced assembly of the autophagy initiation complex. Structural basis of starvation-induced assembly of the autophagy initiation complex. Nature structural & molecular biology 2014 imex curation Fujioka Y., Suzuki SW., Yamamoto H., Kondo-Kakuta C., Kimura Y., Hirano H., Akada R., Inagaki F., Ohsumi Y., Noda NN. Only protein-protein interactions ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Fujioka Y., Suzuki SW., Yamamoto H., Kondo-Kakuta C., Kimura Y., Hirano H., Akada R., Inagaki F., Ohsumi Y., Noda NN. DIP original experiment: DIP-260901X Nature structural & molecular biology 2014 IMEx Structural basis of starvation-induced assembly of the autophagy initiation complex. Structural basis of starvation-induced assembly of the autophagy initiation complex. Structural basis of starvation-induced assembly of the autophagy initiation complex. Nature structural & molecular biology 2014 imex curation Fujioka Y., Suzuki SW., Yamamoto H., Kondo-Kakuta C., Kimura Y., Hirano H., Akada R., Inagaki F., Ohsumi Y., Noda NN. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Fujioka Y., Suzuki SW., Yamamoto H., Kondo-Kakuta C., Kimura Y., Hirano H., Akada R., Inagaki F., Ohsumi Y., Noda NN. DIP original experiment: DIP-260910X Nature structural & molecular biology 2014 IMEx Structural basis of starvation-induced assembly of the autophagy initiation complex. Structural basis of starvation-induced assembly of the autophagy initiation complex. Structural basis of starvation-induced assembly of the autophagy initiation complex. Nature structural & molecular biology 2014 imex curation Fujioka Y., Suzuki SW., Yamamoto H., Kondo-Kakuta C., Kimura Y., Hirano H., Akada R., Inagaki F., Ohsumi Y., Noda NN. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Fujioka Y., Suzuki SW., Yamamoto H., Kondo-Kakuta C., Kimura Y., Hirano H., Akada R., Inagaki F., Ohsumi Y., Noda NN. DIP original experiment: DIP-260900X Nature structural & molecular biology 2014 IMEx Structural basis of starvation-induced assembly of the autophagy initiation complex. Structural basis of starvation-induced assembly of the autophagy initiation complex. Structural basis of starvation-induced assembly of the autophagy initiation complex. Nature structural & molecular biology 2014 imex curation Fujioka Y., Suzuki SW., Yamamoto H., Kondo-Kakuta C., Kimura Y., Hirano H., Akada R., Inagaki F., Ohsumi Y., Noda NN. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Fujioka Y., Suzuki SW., Yamamoto H., Kondo-Kakuta C., Kimura Y., Hirano H., Akada R., Inagaki F., Ohsumi Y., Noda NN. DIP original experiment: DIP-260907X Nature structural & molecular biology 2014 IMEx Structural basis of starvation-induced assembly of the autophagy initiation complex. Structural basis of starvation-induced assembly of the autophagy initiation complex. Structural basis of starvation-induced assembly of the autophagy initiation complex. Nature structural & molecular biology 2014 imex curation Fujioka Y., Suzuki SW., Yamamoto H., Kondo-Kakuta C., Kimura Y., Hirano H., Akada R., Inagaki F., Ohsumi Y., Noda NN. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Fujioka Y., Suzuki SW., Yamamoto H., Kondo-Kakuta C., Kimura Y., Hirano H., Akada R., Inagaki F., Ohsumi Y., Noda NN. DIP original experiment: DIP-260904X Nature structural & molecular biology 2014 IMEx Structural basis of starvation-induced assembly of the autophagy initiation complex. Structural basis of starvation-induced assembly of the autophagy initiation complex. Structural basis of starvation-induced assembly of the autophagy initiation complex. Nature structural & molecular biology 2014 imex curation Fujioka Y., Suzuki SW., Yamamoto H., Kondo-Kakuta C., Kimura Y., Hirano H., Akada R., Inagaki F., Ohsumi Y., Noda NN. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Fujioka Y., Suzuki SW., Yamamoto H., Kondo-Kakuta C., Kimura Y., Hirano H., Akada R., Inagaki F., Ohsumi Y., Noda NN. DIP original experiment: DIP-260905X Nature structural & molecular biology 2014 IMEx Structural basis of starvation-induced assembly of the autophagy initiation complex. Structural basis of starvation-induced assembly of the autophagy initiation complex. Structural basis of starvation-induced assembly of the autophagy initiation complex. Nature structural & molecular biology 2014 imex curation Fujioka Y., Suzuki SW., Yamamoto H., Kondo-Kakuta C., Kimura Y., Hirano H., Akada R., Inagaki F., Ohsumi Y., Noda NN. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Fujioka Y., Suzuki SW., Yamamoto H., Kondo-Kakuta C., Kimura Y., Hirano H., Akada R., Inagaki F., Ohsumi Y., Noda NN. DIP original experiment: DIP-260899X Nature structural & molecular biology 2014 IMEx Structural basis of starvation-induced assembly of the autophagy initiation complex. Structural basis of starvation-induced assembly of the autophagy initiation complex. Structural basis of starvation-induced assembly of the autophagy initiation complex. Nature structural & molecular biology 2014 imex curation Fujioka Y., Suzuki SW., Yamamoto H., Kondo-Kakuta C., Kimura Y., Hirano H., Akada R., Inagaki F., Ohsumi Y., Noda NN. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Fujioka Y., Suzuki SW., Yamamoto H., Kondo-Kakuta C., Kimura Y., Hirano H., Akada R., Inagaki F., Ohsumi Y., Noda NN. DIP original experiment: DIP-260909X Nature structural & molecular biology 2014 IMEx Structural basis of starvation-induced assembly of the autophagy initiation complex. Structural basis of starvation-induced assembly of the autophagy initiation complex. Structural basis of starvation-induced assembly of the autophagy initiation complex. Nature structural & molecular biology 2014 imex curation Fujioka Y., Suzuki SW., Yamamoto H., Kondo-Kakuta C., Kimura Y., Hirano H., Akada R., Inagaki F., Ohsumi Y., Noda NN. Only protein-protein interactions ecolx Escherichia coli pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Fujioka Y., Suzuki SW., Yamamoto H., Kondo-Kakuta C., Kimura Y., Hirano H., Akada R., Inagaki F., Ohsumi Y., Noda NN. DIP original experiment: DIP-260908X Nature structural & molecular biology 2014 IMEx Structural basis of starvation-induced assembly of the autophagy initiation complex. Structural basis of starvation-induced assembly of the autophagy initiation complex. Structural basis of starvation-induced assembly of the autophagy initiation complex. Nature structural & molecular biology 2014 imex curation Fujioka Y., Suzuki SW., Yamamoto H., Kondo-Kakuta C., Kimura Y., Hirano H., Akada R., Inagaki F., Ohsumi Y., Noda NN. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Fujioka Y., Suzuki SW., Yamamoto H., Kondo-Kakuta C., Kimura Y., Hirano H., Akada R., Inagaki F., Ohsumi Y., Noda NN. DIP original experiment: DIP-260903X Nature structural & molecular biology 2014 IMEx Structural basis of starvation-induced assembly of the autophagy initiation complex. Structural basis of starvation-induced assembly of the autophagy initiation complex. Structural basis of starvation-induced assembly of the autophagy initiation complex. Nature structural & molecular biology 2014 imex curation Fujioka Y., Suzuki SW., Yamamoto H., Kondo-Kakuta C., Kimura Y., Hirano H., Akada R., Inagaki F., Ohsumi Y., Noda NN. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Fujioka Y., Suzuki SW., Yamamoto H., Kondo-Kakuta C., Kimura Y., Hirano H., Akada R., Inagaki F., Ohsumi Y., Noda NN. DIP original experiment: DIP-260898X Nature structural & molecular biology 2014 IMEx Structural basis of starvation-induced assembly of the autophagy initiation complex. Structural basis of starvation-induced assembly of the autophagy initiation complex. Structural basis of starvation-induced assembly of the autophagy initiation complex. Nature structural & molecular biology 2014 imex curation Fujioka Y., Suzuki SW., Yamamoto H., Kondo-Kakuta C., Kimura Y., Hirano H., Akada R., Inagaki F., Ohsumi Y., Noda NN. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Fujioka Y., Suzuki SW., Yamamoto H., Kondo-Kakuta C., Kimura Y., Hirano H., Akada R., Inagaki F., Ohsumi Y., Noda NN. DIP original experiment: DIP-260896X Nature structural & molecular biology 2014 IMEx Structural basis of starvation-induced assembly of the autophagy initiation complex. Structural basis of starvation-induced assembly of the autophagy initiation complex. Structural basis of starvation-induced assembly of the autophagy initiation complex. Nature structural & molecular biology 2014 imex curation Fujioka Y., Suzuki SW., Yamamoto H., Kondo-Kakuta C., Kimura Y., Hirano H., Akada R., Inagaki F., Ohsumi Y., Noda NN. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Fujioka Y., Suzuki SW., Yamamoto H., Kondo-Kakuta C., Kimura Y., Hirano H., Akada R., Inagaki F., Ohsumi Y., Noda NN. DIP original experiment: DIP-260906X Nature structural & molecular biology 2014 IMEx Structural basis of starvation-induced assembly of the autophagy initiation complex. atg13_yeast Autophagy-related protein 13 ATG13 APG13 YPR185W protein protein yeast Saccharomyces cerevisiae Baker's yeast MVAEEDIEKQVLQLIDSFFLKTTLLICSTESSRYQSSTENIFLFDDTWFEDHSELVSELPEIISKWSHYDGRKELPPLVVETYLDLRQLNSSHLVRLKDHEGHLWNVCKGTKKQEIVMERWLIELDNSSPTFKSYSEDETDVNELSKQLVLLFRYLLTLIQLLPTTELYQLLIKSYNGPQNEGSSNPITSTGPLVSIRTCVLDGSKPILSKGRIGLSKPIINTYSNALNESNLPAHLDQKKITPVWTKFGLLRVSVSYRRDWKFEINNTNDELFSARHASVSHNSQGPQNQPEQEGQSDQDIGKRQPQFQQQQQPQQQQQQQQQQQRQHQVQTQQQRQIPDRRSLSLSPCTRANSFEPQSWQKKVYPISRPVQPFKVGSIGSQSASRNPSNSSFFNQPPVHRPSMSSNYGPQMNIEGTSVGSTSKYSSSFGNIRRHSSVKTTENAEKVSKAVKSPLQPQESQEDLMDFVKLLEEKPDLTIKKTSGNNPPNINISDSLIRYQNLKPSNDLLSEDLSVSLSMDPNHTYHRGRSDSHSPLPSISPSMHYGSLNSRMSQGANASHLIARGGGNSSTSALNSRRNSLDKSSNKQGMSGLPPIFGGESTSYHHDNKIQKYNQLGVEEDDDDENDRLLNQMGNSATKFKSSISPRSIDSISSSFIKSRIPIRQPYHYSQPTTAPFQAQAKFHKPANKLIDNGNRSNSNNNNHNGNDAVGVMHNDEDDQDDDLVFFMSDMNLSKEG 45CD16F69B795E62 45CD16F69B795E62 atg1_yeast Serine/threonine-protein kinase ATG1 ATG1 APG1 AUT3 YGL180W G1615 CVT10 Autophagy-related protein 1 Autophagy protein 3 Cytoplasm to vacuole targeting protein 10 protein protein yeast Saccharomyces cerevisiae Baker's yeast MGDIKNKDHTTSVNHNLMASAGNYTAEKEIGKGSFATVYRGHLTSDKSQHVAIKEVSRAKLKNKKLLENLEIEIAILKKIKHPHIVGLIDCERTSTDFYLIMEYCALGDLTFLLKRRKELMENHPLLRTVFEKYPPPSENHNGLHRAFVLSYLQQLASALKFLRSKNLVHRDIKPQNLLLSTPLIGYHDSKSFHELGFVGIYNLPILKIADFGFARFLPNTSLAETLCGSPLYMAPEILNYQKYNAKADLWSVGTVVFEMCCGTPPFRASNHLELFKKIKRANDVITFPSYCNIEPELKELICSLLTFDPAQRIGFEEFFANKVVNEDLSSYELEDDLPELESKSKGIVESNMFVSEYLSKQPKSPNSNLAGHQSMADNPAELSDALKNSNILTAPAVKTDHTQAVDKKASNNKYHNSLVSDRSFEREYVVVEKKSVEVNSLADEVAQAGFNPNPIKHPTSTQNQNVLLNEQFSPNNQQYFQNQGENPRLLRATSSSSGGSDGSRRPSLVDRRLSISSLNPSNALSRALGIASTRLFGGANQQQQQQQITSSPPYSQTLLNSQLFHELTENIILRIDHLQHPETLKLDNTNIVSILESLAAKAFVVYSYAEVKFSQIVPLSTTLKGMANFENRRSMDSNAIAEEQDSDDAEEEDETLKKYKEDCLSTKTFGKGRTLSATSQLSATFNKLPRSEMILLCNEAIVLYMKALSILSKSMQVTSNWWYESQEKSCSLRVNVLVQWLREKFNECLEKADFLRLKINDLRFKHASEVAENQTLEEKGSSEEPVYLEKLLYDRALEISKMAAHMELKGENLYNCELAYATSLWMLETSLDDDDFTNAYGDYPFKTNIHLKSNDVEDKEKYHSVLDENDRIIIRKYIDSIANRLKILRQKMNHQN 7F4C785AA3A7CC46 7F4C785AA3A7CC46 c5db94_lactc Autophagy-related protein 13 KLTH0A00704g protein protein lactc Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) Yeast Kluyveromyces thermotolerans MTTSLDKQLWELIDNFFLKAALLICHSKGWKGAPAADEGPPTTNSWFNIETFGDTKLERELKPWTTFDGSESLPPLVIETYLDLARLSPSQQVTLKDQDGNPWNVCKGTKKSEIMLERWLIQLDNGEDSPSLQSSGSEDTDDNVSELYRQLVLLFRYLETLVGLLPASELQARLIRPGVSPEAPPPVKLGTRILDGSKPIVSKGRIGLSKSLIATYSNVINETNLPAHLEQRKITPIRTKFGSLRISVSYRKDCDFHVNGSEEYNTQFNQETRSRSAAPVATPSLRRVSMNSNRSMSISPNTTISPSPLAEPSPQKRGTVLARQLQPFKAGSVGSGSLPQVQQGSLSRNPSATSVAAALRAQRPSNGSITAPTSQLHESHLEPSSIGSGSLSKYSSSFGRLRRQSSVRRSDSVERSQKPSKLNESPSGDLLDFMKLLDDRKELKLKNKGTKVDISNSLLKFQGMRTTNNNLSTDLSMSMSLERPSVSQPRNRSNSHSPNSSFSPSIQYSSIPMRLSQSRSDSYRPEILGELSSARGSTERPKSIISNLNESFYDGRRLGGRTSSNEGYAEDEEDEEDEEDLLVGRSAMNPASTNFRNRSTSPGSVRSVSSSFSKSQLPFKSLSNFSGPTTMATPAHAKLHKAIVGNSPETNVSDALPKKDDSLNQEEDDDLLFFMSDMNLSK DIP protein C5DB94 original sequence version: 23 atg1_klumd Serine/threonine-protein kinase ATG1 Autophagy-related protein 1 KLMA_30321 ATG1 protein protein kluyveromyces marxianus dmku3-1042 Kluyveromyces marxianus DMKU3-1042 MSSESHGKAVAKAIRLPTENYTVEKEIGKGSFAIVYKGVSLRDGRNIAIKAVSRSKLKNKKLLENLEVEIAILKKIKHPHIVGLIDCERTSTDFYLIMEYCALGDLTFFIKKRRSLVMKHPLIKTVFDLYPPPSAEHNGLNRVLVVNYLQQLSSALKFLRSKNLVHRDIKPQNLLLCTPLQDYSDPKTFHEMGFIGIYNLPVLKIADFGFARFLPNTSLAETLCGSPLYMAPEILNYQKYNAKADLWSVGTVLYEMCCGRPPFKASNHLELFQKIKKANDEVTVPSNCYIEPKIFKLIKGLLTFDPEARMGFNEFFNNEVVTEDLSRYEASYEPDLESKSKDVAESNMFVSEYLVRPAAQEKANGGLRTDEGSAMPGAEHTYNKEREHYRERQDLQGQQQQQQQHPDSPPRGSTQGYQSSAGQTRMKSSYNDLILEKEYVVVEKKTVEVNSLADDFANNGPTTNNQGAQIIKPLRYRTSSSSDGHGGRRASLVERRLSISSLSPSNALSKALGLASVRLFGYQQPNTQTTSTSTHPTLLNPQIFHELTENAVLRADHHLNLFNEQISDSNITPFVESLSAKAFVMYSFAEMKFSQILPSPPSSTDYYSQSDKRLSNGSCAIDDDDDLDSGNPSSNQTLTPGANKVSAANVDNLIPAPELKKLCMESLLLYLKSLTILASSMKLTSKWWYENESKNCTLKLNILVQWIRDRFNECLDKAEFLRLKLHTLNQSEDPQVLDDEPTIFVEKLIYDRALDISRNAARLEMEGGNYNTCELAYATSLWMLEILLDEHLSSNEVYDDGYSSNITSLDESDKEMIRKYVSSIANRLKALKSKMS DIP protein W0T9X4 original sequence version: 3 atg17_yeast Autophagy-related protein 17 ATG17 APG17 YLR423C protein protein yeast Saccharomyces cerevisiae Baker's yeast MNEADVTKFVNNARKTLTDAQLLCSSANLRIVDIKKKLSSWQLSISKLNFLIVGLRQQGKFLYTILKEGIGTKLIQKQWNQAVLVVLVDEMKYWQYEITSKVQRLDGIVNELSISEKDDTDPSKLGDYISRDNVNLLNDKLKEVPVIERQIENIKLQYENMVRKVNKELIDTKLTDVTQKFQSKFGIDNLMETNVAEQFSRELTDLEKDLAEIMNSLTQHFDKTLLLQDKKIDNDEREELFKVVQGDDKELYNIFKTLHEVIDDVDKTILNLGQFLQAKIKEKTELHSEVSEIINDFNRNLEYLLIFKDISNLIDSFKNSCTQDIQTTKELCEFYDNFEESYGNLVLEAKRRKDVANRMKTILKDCEKQLQNLDAQDQEERQNFIAENGTYLPETIWPGKIDDFSSLYTLNYNVKNP 71504B6C76549B75 71504B6C76549B75 atg13_klumd Autophagy-related protein 13 ATG13 KLMA_40473 protein protein kluyveromyces marxianus dmku3-1042 Kluyveromyces marxianus DMKU3-1042 MSDSDREIIGLINNFFLKAALLLEQCKVVARGGGFDGEEPLRDGNHLFNIETRGDPTLEAQIQPWTTFDGEKSMPPLVLETFLDLRGLHSNQTVYLHDSDGNPWMVCKGGKKSEIVLERWLIELDRQFSSTTGSTDAAEDDEYNEFNDPENLHKQLVLLFRYLYTLTQLLPANDIITKLQASQQGTAQATTTTGTLKPLHIHTRLLDGSKPILSKGRVGLSKPIIASYSNTMNETNIASHLEQRKITPIKTKFGSLRITVSYRKDVDFYVIDQEDPYKRTTNVSALQDTVTATDRRISSNSNISISVSPKTTNMLNANHIPVDSSGGGFARRQSISSKLQPFKVGSVGSGSFVQSGSLQSVTNPNPSLSRNVSSSSVAAALKVQRGSAGSTVLNSDLPPELSSVGSGSKYSSSFGRIRRHSSVRRSESIDRTAKPRKSNETPPEDLLEFVKLLEDKKELNMKPSTILPQQDISSSLIKFQSMKPNNDTLSDNLSMSMSIDQPNMRMGSNSHSPIPSFSPNYGSIPSRLSQGSRNNSNVELITSRKSSLDRHRLSLLNRTGSNVDIRRGSVGTMETTNEDSKEDEDSHVHGLRFNSGTVNDKTEDNNEDDDEEEILIKRSSNAVASSTEHFSVSPRSARSISVSSYTRSQLPLKHPNFSYPTTSATTAHAKFHKSEVIPDQLHREGSHHHNSSHKNDEDDDLLFVMSDMNLTN DIP protein W0TA43 original sequence version: 2 c5dfj6_lactc Autophagy-related protein 17 KLTH0D15642g protein protein lactc Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) Yeast Kluyveromyces thermotolerans MNEAVIEKLLENSRKFLTGAKLICQESNDHLTTTKLRIREWQKFQSKLHFVLDCIQQQTKFLSEILLREGIGRNLIEEEWSQTVLVRLVNDMKFWQNEITKMMNKLDNITNEIDQQHNSKLGDFISRDSSHILDSKLNEIPTIRKQVENITRQYQTMLAKVQSQLVESRMKGLRDEFSSKFGDQCRENLKLNEEFTNEADQLEQELADFLKSFTDHFDKCSALSSRSVSPEDAQNLFEIVERDDKDLAAINSLLQDAAIDVASFVRKVNMLLDERDADKAKMQATLSKLLTELRKHEEYISVFEGISALIQKFKASCLEDIRQTRNLLDFYANFERSYHNLLKEVKRRKETAAKLSQILKSCETQLEQINTADLRERQMFLLENGNYLPETIWPDEIGSLSPLYTLNYEVRKV DIP protein C5DFJ6 original sequence version: 24 237A6EB8901266F1 ulk1_mouse Serine/threonine-protein kinase ULK1 Ulk1 Unc-51-like kinase 1 Serine/threonine-protein kinase Unc51.1 protein protein mouse Mus musculus Mouse MEPGRGGVETVGKFEFSRKDLIGHGAFAVVFKGRHREKHDLEVAVKCINKKNLAKSQTLLGKEIKILKELKHENIVALYDFQEMANSVYLVMEYCNGGDLADYLHTMRTLSEDTVRLFLQQIAGAMRLLHSKGIIHRDLKPQNILLSNPGGRRANPSNIRVKIADFGFARYLQSNMMAATLCGSPMYMAPEVIMSQHYDGKADLWSIGTIVYQCLTGKAPFQASSPQDLRLFYEKNKTLVPAIPRETSAPLRQLLLALLQRNHKDRMDFDEFFHHPFLDASTPIKKSPPVPVPSYPSSGSGSSSSSSSASHLASPPSLGEMPQLQKTLTSPADAAGFLQGSRDSGGSSKDSCDTDDFVMVPAQFPGDLVAEAASAKPPPDSLLCSGSSLVASAGLESHGRTPSPSPTCSSSPSPSGRPGPFSSNRYGASVPIPVPTQVHNYQRIEQNLQSPTQQQTARSSAIRRSGSTTPLGFGRASPSPPSHTDGAMLARKLSLGGGRPYTPSPQVGTIPERPSWSRVPSPQGADVRVGRSPRPGSSVPEHSPRTTGLGCRLHSAPNLSDFHVVRPKLPKPPTDPLGATFSPPQTSAPQPCPGLQSCRPLRGSPKLPDFLQRSPLPPILGSPTKAGPSFDFPKTPSSQNLLTLLARQGVVMTPPRNRTLPDLSEASPFHGQQLGSGLRPAEDTRGPFGRSFSTSRITDLLLKAAFGTQASDSGSTDSLQEKPMEIAPSAGFGGTLHPGARGGGASSPAPVVFTVGSPPSGATPPQSTRTRMFSVGSSSSLGSTGSSSARHLVPGACGEAPELSAPGHCCSLADPLAANLEGAVTFEAPDLPEETLMEQEHTETLHSLRFTLAFAQQVLEIAALKGSASEAAGGPEYQLQESVVADQISQLSREWGFAEQLVLYLKVAELLSSGLQTAIDQIRAGKLCLSSTVKQVVRRLNELYKASVVSCQGLSLRLQRFFLDKQRLLDGIHGVTAERLILSHAVQMVQSAALDEMFQHREGCVPRYHKALLLLEGLQHTLTDQADIENIAKCKLCIERRLSALLSGVYA DIP protein O70405 original sequence version: 110 DIP protein O70405 original sequence version: 121 DIP protein O70405 original sequence version: 128 mint homomint Involved in axon growth. Plays an essential role in neurite extension of cerebellar granule cells 99B021985FB4E8A0 atg13_human Autophagy-related protein 13 ATG13 KIAA0652 protein protein human Homo sapiens Human METDLNSQDRKDLDKFIKFFALKTVQVIVQARLGEKICTRSSSSPTGSDWFNLAIKDIPEVTHEAKKALAGQLPAVGRSMCVEISLKTSEGDSMELEIWCLEMNEKCDKEIKVSYTVYNRLSLLLKSLLAITRVTPAYRLSRKQGHEYVILYRIYFGEVQLSGLGEGFQTVRVGTVGTPVGTITLSCAYRINLAFMSTRQFERTPPIMGIIIDHFVDRPYPSSSPMHPCNYRTAGEDTGVIYPSVEDSQEVCTTSFSTSPPSQLSSSRLSYQPAALGVGSADLAYPVVFAAGLNATHPHQLMVPGKEGGVPLAPNQPVHGTQADQERLATCTPSDRTHCAATPSSSEDTETVSNSSEGRASPHDVLETIFVRKVGAFVNKPINQVTLTSLDIPFAMFAPKNLELEDTDPMVNPPDSPETESPLQGSLHSDGSSGGSSGNTHDDFVMIDFKPAFSKDDILPMDLGTFYREFQNPPQLSSLSIDIGAQSMAEDLDSLPEKLAVHEKNVREFDAFVETLQ DIP protein O75143 original sequence version: 96 DIP protein O75143-1 original sequence version: 104 DIP protein O75143 original sequence version: 109 DIP protein O75143-1 original sequence version: 121 DIP protein O75143 original sequence version: 107 DIP protein O75143 original sequence version: 115 4D6905985EAB78A7 c5df24_lactc Autophagy-related protein 29 KLTH0D11660g protein protein lactc Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) Yeast Kluyveromyces thermotolerans MNSENTIVYVRVAGRARNGFVDPLKFYWDLERDRSLWSSVSKLDNTKKTIDWKRLSREFKAPEHFIRKRSYALFAKHLKLLERQIEAKTRSLAVTEDELNYTDEDDERNSISHGEDDFEAAEGLKNLRTSKVLKQRVPGEGRNGESSLSELSNLSVSKSALEEALLDRLQL DIP protein C5DF24 original sequence version: 22 B1E3954CF6C71D45 c5deb9_lactc KLTH0C07942g protein protein lactc Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) Yeast Kluyveromyces thermotolerans MSSEANPPVLEPFTVTVVDRNVKHQVEGEPEEEGHPDHEVQGVMFATNVKYIFEDDQELLPEQEDPAIENVVIIEADESLRVTQVELISDQFKQVGYEVRDGNEVCIDALSRFETPRQLGNLPLEKLVQLYKLQNDQLHSLFNTL DIP protein C5DEB9 original sequence version: 24 2C8A7526ADA2AEDC c5deb9_lactc-c5df24_lactc-1 5 26 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 27 unspecified role unspecified role unspecified role unspecified role Region 1-86 Region 1-86 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 23 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association atg1-atg13-2 10 22 unspecified role unspecified role unspecified role unspecified role Region 441-500 Region 441-500 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 20 unspecified role unspecified role unspecified role unspecified role Region 566-836 Region 566-836 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction scatg13-scatg1-1 15 17 unspecified role unspecified role bait bait Region 460-491 Region 460-491 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Q06628:p.[Phe468Ala;Leu472Ala] F468A/L472A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F468A/L472A'. Wed May 02 18:59:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe468ala,leu472ala' Tue Jun 30 20:11:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe468Ala;Leu472Ala]' GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Region 460-521 Region 460-521 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 18 unspecified role unspecified role prey prey Region 587-897 Region 587-897 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction scatg1-scatg13-1 16 17 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 18 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association scatg13-scatg17-1 13 21 unspecified role unspecified role prey prey Q06410:p.[Asp247Ala;Glu250Ala] D247A/E250A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain E A certain certain sequence position certain certain certain sequence position certain D A This feature has been corrected as a result of our quality control procedures. The original label was 'D247A/E250A'. Wed May 02 15:49:02 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp247ala,glu250ala' Tue Jun 30 20:19:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Asp247Ala;Glu250Ala]' Q06410:p.Asp247Ala D247A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain D A This feature has been corrected as a result of our quality control procedures. The original label was 'D247A'. Wed May 02 18:54:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp247ala' Tue Jun 30 19:54:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp247Ala' Q06410:p.[Leu240Ala;Val243Ala] L240A/V243A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain V A certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L240A/V243A'. Wed May 02 15:30:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu240ala,val243ala' Tue Jun 30 16:12:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu240Ala;Val243Ala]' Q06410:p.[Ile213Ala;Ser216Ala] I213A/S216A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain I A This feature has been corrected as a result of our quality control procedures. The original label was 'I213A/S216A'. Wed May 02 16:33:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile213ala,ser216ala' Tue Jun 30 18:49:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ile213Ala;Ser216Ala]' ecolx Escherichia coli 17 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Region 424-436 Region 424-436 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction atg1-atg13-3 6 22 unspecified role unspecified role unspecified role unspecified role Region 441-500 Region 441-500 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 20 unspecified role unspecified role unspecified role unspecified role Region 566-836 Region 566-836 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction scatg13-scatg17-2 7 21 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 17 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Q06628:p.Ser429Asp S429D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain S D This feature has been corrected as a result of our quality control procedures. The original label was 'S429D'. Wed May 02 17:33:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser429asp' Tue Jun 30 17:24:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser429Asp' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association scatg1-scatg13-2 1 17 unspecified role unspecified role unspecified role unspecified role Region 460-491 Region 460-491 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Q06628:p.[Phe468Ala;Leu472Ala] F468A/L472A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F468A/L472A'. Wed May 02 14:30:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe468ala,leu472ala' Tue Jun 30 18:19:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe468Ala;Leu472Ala]' Q06628:p.Phe468Ala F468A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F468A'. Wed May 02 15:08:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe468ala' Tue Jun 30 19:42:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe468Ala' ecolx Escherichia coli 18 unspecified role unspecified role unspecified role unspecified role Region 587-897 Region 587-897 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction atg1-atg13-4 4 22 unspecified role unspecified role prey prey Region 441-500 Region 441-500 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 20 unspecified role unspecified role bait bait Region 566-836 Region 566-836 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association atg13-ulk1-1 12 24 unspecified role unspecified role prey prey Region 834-1051 Region 834-1051 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 25 unspecified role unspecified role bait bait Region 458-517 Region 458-517 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction scatg13-scatg17-3 8 21 unspecified role unspecified role prey prey Q06410:p.Asp247Ala D247A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain D A This feature has been corrected as a result of our quality control procedures. The original label was 'D247A'. Wed May 02 15:25:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp247ala' Tue Jun 30 17:23:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp247Ala' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 17 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association scatg1-scatg13-3 14 17 unspecified role unspecified role prey prey Region 460-491 Region 460-491 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Q06628:p.[Phe468Ala;Leu472Ala] F468A/L472A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F468A/L472A'. Wed May 02 18:08:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe468ala,leu472ala' Tue Jun 30 17:53:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe468Ala;Leu472Ala]' Q06628:p.Phe468Ala F468A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F468A'. Wed May 02 19:49:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe468ala' Tue Jun 30 19:50:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe468Ala' Q06628:p.Leu472Ala L472A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L472A'. Wed May 02 17:05:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu472ala' Tue Jun 30 16:07:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu472Ala' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 18 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association Deletion of region 492-521 decreased the interaction rate/strength. scatg13-scatg17-4 2 21 unspecified role unspecified role prey prey ecolx Escherichia coli 17 unspecified role unspecified role bait bait Region 424-436 Region 424-436 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q06628:p.[Ser428Ala;Ser429Ala] S428A/S429A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain S A This feature has been corrected as a result of our quality control procedures. The original label was 'S428A/S429A'. Wed May 02 19:22:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser428ala,ser429ala' Tue Jun 30 17:21:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser428Ala;Ser429Ala]' Q06628:p.[Phe430Ala;Ile433Ala] F430A/I433A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain I A certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F430A/I433A'. Wed May 02 20:06:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe430ala,ile433ala' Tue Jun 30 19:27:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe430Ala;Ile433Ala]' Q06628:p.[Arg434Ala;Arg435Ala] R434A/R435A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R434A/R435A'. Wed May 02 20:31:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg434ala,arg435ala' Tue Jun 30 18:38:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg434Ala;Arg435Ala]' Q06628:p.Ser429Asp S429D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain S D This feature has been corrected as a result of our quality control procedures. The original label was 'S429D'. Wed May 02 17:55:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser429asp' Tue Jun 30 17:37:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser429Asp' ecolx Escherichia coli direct interaction direct interaction c5db94_lactc-c5deb9_lactc-1 11 19 unspecified role unspecified role unspecified role unspecified role Region 392-404 Region 392-404 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 26 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 27 unspecified role unspecified role unspecified role unspecified role Region 1-86 Region 1-86 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 23 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association c5df24_lactc-c5deb9_lactc-1 3 26 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 27 unspecified role unspecified role prey prey Region 1-86 Region 1-86 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 23 unspecified role unspecified role prey prey ecolx Escherichia coli association association scatg13-scatg17-5 9 21 unspecified role unspecified role unspecified role unspecified role Q06410:p.Asp247Ala D247A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain D A This feature has been corrected as a result of our quality control procedures. The original label was 'D247A'. Wed May 02 18:59:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp247ala' Tue Jun 30 19:09:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp247Ala' Q06410:p.[Asp247Ala;Glu250Ala] D247A/E250A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain E A certain certain sequence position certain certain certain sequence position certain D A This feature has been corrected as a result of our quality control procedures. The original label was 'D247A/E250A'. Wed May 02 19:19:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp247ala,glu250ala' Tue Jun 30 16:47:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Asp247Ala;Glu250Ala]' ecolx Escherichia coli 17 unspecified role unspecified role unspecified role unspecified role Region 424-436 Region 424-436 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro direct interaction direct interaction