DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Translation initiation factor eIF3b contains a nine-bladed β-propeller and interacts with the 40S ribosomal subunit. Translation initiation factor eIF3b contains a nine-bladed β-propeller and interacts with the 40S ribosomal subunit. Structure (London, England : 1993) 2014 imex curation Liu Y., Neumann P., Kuhle B., Monecke T., Schell S., Chari A., Ficner R. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Liu Y., Neumann P., Kuhle B., Monecke T., Schell S., Chari A., Ficner R. DIP original experiment: DIP-261900X Structure (London, England : 1993) 2014 IMEx Translation initiation factor eIF3b contains a nine-bladed β-propeller and interacts with the 40S ribosomal subunit. Translation initiation factor eIF3b contains a nine-bladed β-propeller and interacts with the 40S ribosomal subunit. Translation initiation factor eIF3b contains a nine-bladed β-propeller and interacts with the 40S ribosomal subunit. Structure (London, England : 1993) 2014 imex curation Liu Y., Neumann P., Kuhle B., Monecke T., Schell S., Chari A., Ficner R. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Liu Y., Neumann P., Kuhle B., Monecke T., Schell S., Chari A., Ficner R. DIP original experiment: DIP-261899X Structure (London, England : 1993) 2014 IMEx Translation initiation factor eIF3b contains a nine-bladed β-propeller and interacts with the 40S ribosomal subunit. Translation initiation factor eIF3b contains a nine-bladed β-propeller and interacts with the 40S ribosomal subunit. Translation initiation factor eIF3b contains a nine-bladed β-propeller and interacts with the 40S ribosomal subunit. Structure (London, England : 1993) 2014 imex curation Liu Y., Neumann P., Kuhle B., Monecke T., Schell S., Chari A., Ficner R. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Liu Y., Neumann P., Kuhle B., Monecke T., Schell S., Chari A., Ficner R. DIP original experiment: DIP-261898X Structure (London, England : 1993) 2014 IMEx Translation initiation factor eIF3b contains a nine-bladed β-propeller and interacts with the 40S ribosomal subunit. Translation initiation factor eIF3b contains a nine-bladed β-propeller and interacts with the 40S ribosomal subunit. Translation initiation factor eIF3b contains a nine-bladed β-propeller and interacts with the 40S ribosomal subunit. Structure (London, England : 1993) 2014 imex curation Liu Y., Neumann P., Kuhle B., Monecke T., Schell S., Chari A., Ficner R. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Liu Y., Neumann P., Kuhle B., Monecke T., Schell S., Chari A., Ficner R. DIP original experiment: DIP-261901X Structure (London, England : 1993) 2014 IMEx Translation initiation factor eIF3b contains a nine-bladed β-propeller and interacts with the 40S ribosomal subunit. Translation initiation factor eIF3b contains a nine-bladed β-propeller and interacts with the 40S ribosomal subunit. Translation initiation factor eIF3b contains a nine-bladed β-propeller and interacts with the 40S ribosomal subunit. Structure (London, England : 1993) 2014 imex curation Liu Y., Neumann P., Kuhle B., Monecke T., Schell S., Chari A., Ficner R. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Liu Y., Neumann P., Kuhle B., Monecke T., Schell S., Chari A., Ficner R. DIP original experiment: DIP-261902X Structure (London, England : 1993) 2014 IMEx Translation initiation factor eIF3b contains a nine-bladed β-propeller and interacts with the 40S ribosomal subunit. g0rxs6_chatd Eukaryotic translation initiation factor 3 subunit B PRT1 Eukaryotic translation initiation factor 3 90 kDa subunit homolog Translation initiation factor eIF3, p90 subunit homolog CTHT_0000230 protein protein chatd Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) MAPSFDHLREEDLDEEDIDMDEVDISDLREKYEVQLEQGYDTFVVIDGLPAVSEEQKPKLIKFLLKKLNTVGKTREDMIYMPMGDDGMSLRFAFVEYSSPAEASAAVRQLDYVPLDKKHTLRVNKLTDIDRYGREGRISEEFVPPKIEPFQEKEHLRWFMADPADRGRDQFVMYRGDTVGVFWNNEKDQPENIVDRQHWTETFVQWSPLGTYLTSVHAQGVQLWGGASWSRLRRFPHPFVNLVAFSPGEKYLVTWSNRPIQIPDSGHPVLTLDDDGKNYIIWDIETARPLRSFAQQDIHPEEHGPKKGPPKFPWPVFKWSADDKYVARLNQGTSISIYELPKMNLLDKQAVKIEGVMDFEWAPATVQREGVKTYEQLFCFWTPEIGNNPARVGLMSIPSKQIVRTLNLFSVSDVKMHWQSEGTYLCVKVDRHSKSKKSQATTLEIFRVKEKGVPVEVVDTIKDTVINFAWEPKGDRFVIITTPEPVGATAVPPKTSVSFFCPELKKGNQVGSFKHLRTLEKKNHNAIYWSPKGRFVVIATVHNTQSSDLEFWDLDFDGEKPENEKDLAACLQLMGTGDHYGITDVEWDPSGRYVATWASAWKHTMENGYHLYDFKGELLREEHIEKFKQWQWRPRPPTLLTKEEQKQIRKNLREYSRIFEQEDAERISSADVAVVEARRRLLNEWYAWREAIEKEVAEERAALGLPADPAAELLKRKIAEVAPDAQEQVIEEIMEEVLEETEEIVN DIP protein G0RXS6 original sequence version: 17 g0s5v8_chatd Eukaryotic translation initiation factor 3 subunit G TIF35 Eukaryotic translation initiation factor 3 RNA-binding subunit Translation initiation factor eIF3 p33 subunit homolog CTHT_0033790 protein protein chatd Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) MAARTKHDWADDEDIEETTNDLPPPQKIQNKDGSTTIIEYRYNENGQKVKTTRRIRYITHREVVSPLVAERKTWAKFGASAKDPPGPASDTTSVGENIIFRPSVNWKKEAKDESKDPNAQAMKDKLKDKKVKCRICNGEHFTARCPYKDTMAPIGETAPADVAAGLGDEAPGAAGPGKKGSYIPPALRAGARPEGDRLGGKYGERDDMATLRVTNVSELAEESELREMFERFGRVTRVFLAKDRETGLAKGFAFISFADRADAVRACQKMDGFGFKHLILRVEFAKKAQ DIP protein G0S5V8 original sequence version: 15 g0s9h3_chatd Eukaryotic translation initiation factor 3 subunit I TIF34 Eukaryotic translation initiation factor 3 39 kDa subunit homolog CTHT_0045890 protein protein chatd Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) MRPILLKGHERALTQIRYNREGDLIFSVSKDQQICVWFSHNGERLGTYRGHQGAIWTVDVDPTTTMIASGSADNTIRLWDVKTGRLLKTWDFPTAIKRVEFNEDGTKLVAVTEKRMGHLGTIVVLNINPDVNAEQSDEKALVIVCEESKATVAGWSYLSKYIIAGHEDGSISQYDAKTGDLLLNIPIHELNNPITDLQWSADRTYFITASKDKTAKLITAKDLEVLKTYTADTPLNSATITAKKDFVILGGGQAAMEVTTTAVRQGKFEARFYHKIFEDEIGRVRGHFGPLNTVAADPTGKGYASGGEDGYVRVHHFDKGYFDFMYEVERERANKLAQQAAQAQAAAAPATAKA DIP protein G0S9H3 original sequence version: 14 g0shb1_chatd Eukaryotic translation initiation factor 3 subunit A TIF32 Eukaryotic translation initiation factor 3 110 kDa subunit homolog Translation initiation factor eIF3, p110 subunit homolog CTHT_0069380 protein protein chatd Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) MPPPPHQKPENVLKRAQELIGVNQAPAALSLLHEHVTSKRSRNVPITSLEPVMLLLVELAVEQKKGKLAKDALYQYKNIAQNTNVATIELVLKKFIELASEKVKAAQQKAEEVQSSIESAAVEDLEASETPESILLATVSGEQSKDRTDRAIVTPWLKFLWEAYRTVLDILRNNARLEILYQSTAMQAFDFCLKYTRKTEFRRLCELLRNHVQTAAKYSAQMHAINLSDPDTLQRHLETRFQQLNVAVDLELWQEAFRSVEDIHTLLTLSKRPPKNIMMANYYEKLTRIFLVGENYLFHAAAWLRYYNLLRHSAALLATGQSKKADNPPATEADLQKAATFVVLSALSIPVISTSRSRGAMVDFDEARKTKNSRLTHLLGMTQAPTRASLFRDVQSKSLLRRAQPQIRELYTILEVDFHPLSICQKISPILKQIGADPEMQKYIAPLQQVILTRLFQQLSQVYETVDLSFVESLAQFPEPFQVSRGMIEKFIMNGNKKGDLSIRMDHATGVLSFDVDVFSSARAAHAGSAAGSAESETGSVQRLQSTPSQIVRSQLTRLAEALFTSCRYIDPSFNEAQIKAREAALARAKAGAEKEHLEVLARKEIIQRRKDQASEAQAQREKENARRKMLQEQALQQAEAARLAEEARIREQKRLQSEREAIKRKEVENMLKDMKLDSVNLEDLENLDSNKIRMIKLQQLEREKNTIAEKLRITGKRLDHLERAYRREEAKKLPEDYAKQRERDLAAYEAMKARTLKEAEQKHKEDLELKHRLSRLMPFYESFRAELHERRREQFEKRRRDAEREFEKAVNQRRKEYRERKLREKREREEKERALREAEERAAREREEERKRQEARREELQRLREEREKERERAREAAARQQQREEEAMARRRAEKEKQAAAAAAGSLPIREPQPISTSGPPRLNLIGGKTPTWREREAAKQAAAAGGAAPPSENNTPPPAARPTPPPMERSSSSDVPSAGPPRLPLAGAAKPGGWRERLAAKEAAAKEAAASGNAPPPGPPPRTGSGRGVPLDRTGSGRGVPLDRVGSGRGGSKDSKEPAPEPLKPSGAPGKWVPRFRRENAGN DIP protein G0SHB1 original sequence version: 9 g0sfl2_chatd Eukaryotic translation initiation factor 3 subunit C NIP1 Eukaryotic translation initiation factor 3 93 kDa subunit homolog Translation initiation factor eIF3, p93 subunit homolog CTHT_0071240 protein protein chatd Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) MSRFFRGGDSSTESSSDEEELYTTSEEEEEEEIEEQEESEEEEEEDEESSSSDDEGAARTGVNRFLRAMSESESESDDEEGQHKVKSAKDKRHEELEATIIAIQNSQKINDWSTIANEFDKLNRQVVKLVEGGKAPKSYIKCIAELEDFLNETLAKQKVTPKKMNATNARGLNAVKQKIKKNNKEYQSQIDAFRKDADAFMESSDEEEVPLPPKPTKVKFQDAFVAEEGPEDEEKGFSKVDKRGKAVPYSPESIQKHLRAIIESRGRKNVDRMEQIRVMEELTKIAEIPYLKIRVLQTLISTRFDLGSGAAAAMPLEQWKAAEKELSTLLTILEENKDHVVLENAEDLDDDEKVPTLGPDDKHIKIPGSVVSYIERLDDELTRSLQNIDPHTSEYIERLTDETSVYNLILKGLLYYETIRKDASLDVPQESLNRVIQRRLEHVYFKPAQVVKILEENSWKRVAGEINSSITPRSLSADPSKLIQVLCSYLFDNSEGIIRARAMLCQIYFLALHDEYYKARDMMLTSHLQENITNFDIATQILYNRTLVQVGLCAFRKGLIYDAQNTLQDICGSGRQKELLAQGVMIQRYSQVSPEQERLEKQRQLPFHMHINLELLECVYLTCSMLLEIPLLAQTGSSPDIKKRVISKTYRRMLEYHERQIFTGPPENTRDHVMQASKALAAGEWKKAIDFIHSIKIWDLMPKADEIKVMLAKQIQEEGLRTYLFTYAPFYDTLSIDTLSTMFELEPRKVASVVSKMISYEELAAALDQVTNTIIFRKGVELSRLQSLALALSDKASALIETNERTLEQRTQGSASAFNRKDGRQGGQRTGGQRTGRSGPRPGGNTQRQAGGTQFTGGALGAAVRG DIP protein G0SFL2 original sequence version: 13 g0sgx1_chatd CTHT_0067870 protein protein chatd Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) MMASTTRPGLVSALRGVSRRITSRQCRSLEHQFRLLSISTPCSSDMALEPIKPGSADIQAAPEIDLVALAKKYRLAEHARTVPASPSYFSKSPKFNDAFVRVEALYRKYGHLPTLPPADVERVAWKRLKDARTDFNERVKATDYVRCLFIVKSLHSIHPDLKPAEVTEALQVFKRDIQGFLNKPKPVPIDKYGRALGVGKRKASTARAYVLEGNGEVLINGKTLAEYFGRVHDRETAIWPLTATDRIDKYNVWVRVEGGGTTGQADAIKLAIAKGLLAHEPALKPALRRAGCITRDPRTVERKKPGRKKARKGLTWVKR DIP protein G0SGX1 original sequence version: 10 nip1-prt1-22 3 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 8 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 10 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association prt1-tif34-32 1 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 8 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association g0sgx1_chatd-prt1-1 5 11 unspecified role unspecified role bait bait Region 1-183 Region 1-183 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 6 unspecified role unspecified role prey prey Region 167-746 Region 167-746 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction g0sgx1_chatd-prt1-2 4 11 unspecified role unspecified role bait bait Region 1-183 Region 1-183 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 7 unspecified role unspecified role prey prey ecolx Escherichia coli 8 unspecified role unspecified role prey prey ecolx Escherichia coli 6 unspecified role unspecified role prey prey Region 167-746 Region 167-746 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli association association nip1-prt1-23 2 10 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association