DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu NRROS negatively regulates reactive oxygen species during host defence and autoimmunity. NRROS negatively regulates reactive oxygen species during host defence and autoimmunity. Nature 2014 imex curation Noubade R., Wong K., Ota N., Rutz S., Eidenschenk C., Valdez PA., Ding J., Peng I., Sebrell A., Caplazi P., DeVoss J., Soriano RH., Sai T., Lu R., Modrusan Z., Hackney J., Ouyang W. Only protein-protein interactions crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Noubade R., Wong K., Ota N., Rutz S., Eidenschenk C., Valdez PA., Ding J., Peng I., Sebrell A., Caplazi P., DeVoss J., Soriano RH., Sai T., Lu R., Modrusan Z., Hackney J., Ouyang W. DIP original experiment: DIP-260842X Nature 2014 IMEx NRROS negatively regulates reactive oxygen species during host defence and autoimmunity. NRROS negatively regulates reactive oxygen species during host defence and autoimmunity. NRROS negatively regulates reactive oxygen species during host defence and autoimmunity. Nature 2014 imex curation Noubade R., Wong K., Ota N., Rutz S., Eidenschenk C., Valdez PA., Ding J., Peng I., Sebrell A., Caplazi P., DeVoss J., Soriano RH., Sai T., Lu R., Modrusan Z., Hackney J., Ouyang W. Only protein-protein interactions crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Noubade R., Wong K., Ota N., Rutz S., Eidenschenk C., Valdez PA., Ding J., Peng I., Sebrell A., Caplazi P., DeVoss J., Soriano RH., Sai T., Lu R., Modrusan Z., Hackney J., Ouyang W. DIP original experiment: DIP-260844X Nature 2014 IMEx NRROS negatively regulates reactive oxygen species during host defence and autoimmunity. NRROS negatively regulates reactive oxygen species during host defence and autoimmunity. NRROS negatively regulates reactive oxygen species during host defence and autoimmunity. Nature 2014 imex curation Noubade R., Wong K., Ota N., Rutz S., Eidenschenk C., Valdez PA., Ding J., Peng I., Sebrell A., Caplazi P., DeVoss J., Soriano RH., Sai T., Lu R., Modrusan Z., Hackney J., Ouyang W. Only protein-protein interactions crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Noubade R., Wong K., Ota N., Rutz S., Eidenschenk C., Valdez PA., Ding J., Peng I., Sebrell A., Caplazi P., DeVoss J., Soriano RH., Sai T., Lu R., Modrusan Z., Hackney J., Ouyang W. DIP original experiment: DIP-260843X Nature 2014 IMEx NRROS negatively regulates reactive oxygen species during host defence and autoimmunity. NRROS negatively regulates reactive oxygen species during host defence and autoimmunity. NRROS negatively regulates reactive oxygen species during host defence and autoimmunity. Nature 2014 imex curation Noubade R., Wong K., Ota N., Rutz S., Eidenschenk C., Valdez PA., Ding J., Peng I., Sebrell A., Caplazi P., DeVoss J., Soriano RH., Sai T., Lu R., Modrusan Z., Hackney J., Ouyang W. Only protein-protein interactions crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Noubade R., Wong K., Ota N., Rutz S., Eidenschenk C., Valdez PA., Ding J., Peng I., Sebrell A., Caplazi P., DeVoss J., Soriano RH., Sai T., Lu R., Modrusan Z., Hackney J., Ouyang W. DIP original experiment: DIP-260845X Nature 2014 IMEx NRROS negatively regulates reactive oxygen species during host defence and autoimmunity. NRROS negatively regulates reactive oxygen species during host defence and autoimmunity. NRROS negatively regulates reactive oxygen species during host defence and autoimmunity. Nature 2014 imex curation Noubade R., Wong K., Ota N., Rutz S., Eidenschenk C., Valdez PA., Ding J., Peng I., Sebrell A., Caplazi P., DeVoss J., Soriano RH., Sai T., Lu R., Modrusan Z., Hackney J., Ouyang W. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Noubade R., Wong K., Ota N., Rutz S., Eidenschenk C., Valdez PA., Ding J., Peng I., Sebrell A., Caplazi P., DeVoss J., Soriano RH., Sai T., Lu R., Modrusan Z., Hackney J., Ouyang W. DIP original experiment: DIP-260841X Nature 2014 IMEx NRROS negatively regulates reactive oxygen species during host defence and autoimmunity. NRROS negatively regulates reactive oxygen species during host defence and autoimmunity. NRROS negatively regulates reactive oxygen species during host defence and autoimmunity. Nature 2014 imex curation Noubade R., Wong K., Ota N., Rutz S., Eidenschenk C., Valdez PA., Ding J., Peng I., Sebrell A., Caplazi P., DeVoss J., Soriano RH., Sai T., Lu R., Modrusan Z., Hackney J., Ouyang W. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Noubade R., Wong K., Ota N., Rutz S., Eidenschenk C., Valdez PA., Ding J., Peng I., Sebrell A., Caplazi P., DeVoss J., Soriano RH., Sai T., Lu R., Modrusan Z., Hackney J., Ouyang W. DIP original experiment: DIP-260840X Nature 2014 IMEx NRROS negatively regulates reactive oxygen species during host defence and autoimmunity. lrc33_mouse Transforming growth factor beta activator LRRC33 Negative regulator of reactive oxygen species Nrros Lrrc33 Leucine-rich repeat-containing protein 33 protein protein mouse Mus musculus Mouse MEFPPLWLCLGFHFLIVEWRSGPGTATAASQGGCKVVDGVADCRGLNLASVPSSLPPHSRMLILDANPLKDLWNHSLQAYPRLENLSLHSCHLDRISHYAFREQGHLRNLVLADNRLSENYKESAAALHTLLGLRRLDLSGNSLTEDMAALMLQNLSSLEVVSLARNTLMRLDDSIFEGLEHLVELDLQRNYIFEIEGGAFDGLTELRRLNLAYNNLPCIVDFSLTQLRFLNVSYNILEWFLAAREEVAFELEILDLSHNQLLFFPLLPQCGKLHTLLLQDNNMGFYRELYNTSSPQEMVAQFLLVDGNVTNITTVNLWEEFSSSDLSALRFLDMSQNQFRHLPDGFLKKTPSLSHLNLNQNCLKMLHIREHEPPGALTELDLSHNQLAELHLAPGLTGSLRNLRVFNLSSNQLLGVPTGLFDNASSITTIDMSHNQISLCPQMVPVDWEGPPSCVDFRNMGSLRSLSLDGCGLKALQDCPFQGTSLTHLDLSSNWGVLNGSISPLWAVAPTLQVLSLRDVGLGSGAAEMDFSAFGNLRALDLSGNSLTSFPKFKGSLALRTLDLRRNSLTALPQRVVSEQPLRGLQTIYLSQNPYDCCGVEGWGALQQHFKTVADLSMVTCNLSSKIVRVVELPEGLPQGCKWEQVDTGLFYLVLILPSCLTLLVACTVVFLTFKKPLLQVIKSRCHWSSIY DIP protein Q8BMT4 original sequence version: 109 cy24b_mouse Cytochrome b-245 heavy chain Cybb Cgd CGD91-phox Cytochrome b(558) subunit beta Heme-binding membrane glycoprotein gp91phox Neutrophil cytochrome b 91 kDa polypeptide gp91-1 gp91-phox p22 phagocyte B-cytochrome protein protein mouse Mus musculus Mouse MGNWAVNEGLSIFVILVWLGLNVFLFINYYKVYDDGPKYNYTRKLLGSALALARAPAACLNFNCMLILLPVCRNLLSFLRGSSACCSTRIRRQLDRNLTFHKMVAWMIALHTAIHTIAHLFNVEWCVNARVGISDRYSIALSDIGDNENEEYLNFAREKIKNPEGGLYVAVTRLAGITGIVITLCLILIITSSTKTIRRSYFEVFWYTHHLFVIFFIGLAIHGAERIVRGQTAESLEEHNLDICADKIEEWGKIKECPVPKFAGNPPMTWKWIVGPMFLYLCERLVRFWRSQQKVVITKVVTHPFKTIELQMKKKGFKMEVGQYIFVKCPKVSKLEWHPFTLTSAPEEDFFSIHIRIVGDWTEGLFNACGCDKQEFQDAWKLPKIAVDGPFGTASEDVFSYEVVMLVGAGIGVTPFASILKSVWYKYCDNATSLKLKKIYFYWLCRDTHAFEWFADLLQLLETQMQERNNANFLSYNIYLTGWDESQANHFAVHHDEEKDVITGLKQKTLYGRPNWDNEFKTIASEHPNTTIGVFLCGPEALAETLSKQSISNSESGPRGVHFIFNKENF DIP protein Q61093 original sequence version: 110 8816274E3D253DFA cy24a_mouse Cytochrome b-245 light chain Cyba Cytochrome b(558) alpha chain Cytochrome b558 subunit alpha Neutrophil cytochrome b 22 kDa polypeptide Superoxide-generating NADPH oxidase light chain subunit p22 phagocyte B-cytochrome p22-phox protein protein mouse Mus musculus Mouse MGQIEWAMWANEQALASGLILITGGIVATAGRFTQWYFGAYSIAAGVLICLLEYPRGKRKKGSTMERCGQKYLTSVVKLFGPLTRNYYVRAALHFLLSVPAGFLLATILGTVCLAIASVIYLLAAIRGEQWTPIEPKPKERPQVGGTIKQPPTNPPPRPPAEVRKKPSEGEEEAASAGGPQVNPMPVTDEVV DIP protein Q61462 original sequence version: 74 DIP protein Q61462 original sequence version: 113 cybb-cyba-1 6 9 unspecified role unspecified role prey prey mouse Mus musculus Mouse 7 unspecified role unspecified role prey prey mouse Mus musculus Mouse 8 unspecified role unspecified role bait bait mouse Mus musculus Mouse association association cybb-cyba-2 4 9 unspecified role unspecified role prey prey crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster 7 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster 8 unspecified role unspecified role bait bait crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster association association cybb-nrros-1 3 7 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster 8 unspecified role unspecified role bait bait crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster physical association physical association cybb-cyba-3 5 9 unspecified role unspecified role prey prey mouse Mus musculus Mouse 8 unspecified role unspecified role bait bait mouse Mus musculus Mouse physical association physical association cybb-cyba-4 2 9 unspecified role unspecified role prey prey crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster 8 unspecified role unspecified role bait bait crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster physical association physical association nrros-cybb-1 1 7 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster 8 unspecified role unspecified role prey prey crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster physical association physical association