DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Crystal structure of ATP-bound Get3-Get4-Get5 complex reveals regulation of Get3 by Get4. Crystal structure of ATP-bound Get3-Get4-Get5 complex reveals regulation of Get3 by Get4. Nature structural & molecular biology 2014 imex curation Gristick HB., Rao M., Chartron JW., Rome ME., Shan SO., Clemons WM. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Gristick HB., Rao M., Chartron JW., Rome ME., Shan SO., Clemons WM. DIP original experiment: DIP-260881X Nature structural & molecular biology 2014 IMEx Crystal structure of ATP-bound Get3-Get4-Get5 complex reveals regulation of Get3 by Get4. Crystal structure of ATP-bound Get3-Get4-Get5 complex reveals regulation of Get3 by Get4. Crystal structure of ATP-bound Get3-Get4-Get5 complex reveals regulation of Get3 by Get4. Nature structural & molecular biology 2014 imex curation Gristick HB., Rao M., Chartron JW., Rome ME., Shan SO., Clemons WM. Only protein-protein interactions ecolx Escherichia coli ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom predetermined predetermined participant predetermined Gristick HB., Rao M., Chartron JW., Rome ME., Shan SO., Clemons WM. DIP original experiment: DIP-260883X Nature structural & molecular biology 2014 IMEx Crystal structure of ATP-bound Get3-Get4-Get5 complex reveals regulation of Get3 by Get4. Crystal structure of ATP-bound Get3-Get4-Get5 complex reveals regulation of Get3 by Get4. Crystal structure of ATP-bound Get3-Get4-Get5 complex reveals regulation of Get3 by Get4. Nature structural & molecular biology 2014 imex curation Gristick HB., Rao M., Chartron JW., Rome ME., Shan SO., Clemons WM. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Gristick HB., Rao M., Chartron JW., Rome ME., Shan SO., Clemons WM. DIP original experiment: DIP-260880X Nature structural & molecular biology 2014 IMEx Crystal structure of ATP-bound Get3-Get4-Get5 complex reveals regulation of Get3 by Get4. Crystal structure of ATP-bound Get3-Get4-Get5 complex reveals regulation of Get3 by Get4. Crystal structure of ATP-bound Get3-Get4-Get5 complex reveals regulation of Get3 by Get4. Nature structural & molecular biology 2014 imex curation Gristick HB., Rao M., Chartron JW., Rome ME., Shan SO., Clemons WM. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Gristick HB., Rao M., Chartron JW., Rome ME., Shan SO., Clemons WM. DIP original experiment: DIP-260882X Nature structural & molecular biology 2014 IMEx Crystal structure of ATP-bound Get3-Get4-Get5 complex reveals regulation of Get3 by Get4. Crystal structure of ATP-bound Get3-Get4-Get5 complex reveals regulation of Get3 by Get4. Crystal structure of ATP-bound Get3-Get4-Get5 complex reveals regulation of Get3 by Get4. Nature structural & molecular biology 2014 imex curation Gristick HB., Rao M., Chartron JW., Rome ME., Shan SO., Clemons WM. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Gristick HB., Rao M., Chartron JW., Rome ME., Shan SO., Clemons WM. DIP original experiment: DIP-260885X Nature structural & molecular biology 2014 IMEx Crystal structure of ATP-bound Get3-Get4-Get5 complex reveals regulation of Get3 by Get4. Crystal structure of ATP-bound Get3-Get4-Get5 complex reveals regulation of Get3 by Get4. Crystal structure of ATP-bound Get3-Get4-Get5 complex reveals regulation of Get3 by Get4. Nature structural & molecular biology 2014 imex curation Gristick HB., Rao M., Chartron JW., Rome ME., Shan SO., Clemons WM. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Gristick HB., Rao M., Chartron JW., Rome ME., Shan SO., Clemons WM. DIP original experiment: DIP-260884X Nature structural & molecular biology 2014 IMEx Crystal structure of ATP-bound Get3-Get4-Get5 complex reveals regulation of Get3 by Get4. mdy2_yeast Ubiquitin-like protein MDY2 MDY2 TMA24 Mating-deficient protein 2 Translation machinery-associated protein 24 GET5 Golgi to ER traffic protein 5 YOL111C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSTSASGPEHEFVSKFLTLATLTEPKLPKSYTKPLKDVTNLGVPLPTLKYKYKQNRAKKLKLHQDQQGQDNAAVHLTLKKIQAPKFSIEHDFSPSDTILQIKQHLISEEKASHISEIKLLLKGKVLHDNLFLSDLKVTPANSTITVMIKPNPTISKEPEAEKSTNSPAPAPPQELTVPWDDIEALLKNNFENDQAAVRQVMERLQKGWSLAK CE6FC4282E0E472C CE6FC4282E0E472C get3_yeast ATPase GET3 YDL100C GET3 ARR4 D2371 Arsenical pump-driving ATPase Arsenite-stimulated ATPase Guided entry of tail-anchored proteins 3 Golgi to ER traffic protein 3 protein protein yeast Saccharomyces cerevisiae Baker's yeast MDLTVEPNLHSLITSTTHKWIFVGGKGGVGKTTSSCSIAIQMALSQPNKQFLLISTDPAHNLSDAFGEKFGKDARKVTGMNNLSCMEIDPSAALKDMNDMAVSRANNNGSDGQGDDLGSLLQGGALADLTGSIPGIDEALSFMEVMKHIKRQEQGEGETFDTVIFDTAPTGHTLRFLQLPNTLSKLLEKFGEITNKLGPMLNSFMGAGNVDISGKLNELKANVETIRQQFTDPDLTTFVCVCISEFLSLYETERLIQELISYDMDVNSIIVNQLLFAENDQEHNCKRCQARWKMQKKYLDQIDELYEDFHVVKMPLCAGEIRGLNNLTKFSQFLNKEYNPITDGKVIYELEDKE F795C359B5A4A461 F795C359B5A4A461 get4_yeast Golgi to ER traffic protein 4 GET4 O3580 YOR164C Guided entry of tail-anchored proteins 4 protein protein yeast Saccharomyces cerevisiae Baker's yeast MVPAESNAVQAKLAKTLQRFENKIKAGDYYEAHQTLRTIANRYVRSKSYEHAIELISQGALSFLKAKQGGSGTDLIFYLLEVYDLAEVKVDDISVARLVRLIAELDPSEPNLKDVITGMNNWSIKFSEYKFGDPYLHNTIGSKLLEGDFVYEAERYFMLGTHDSMIKYVDLLWDWLCQVDDIEDSTVAEFFSRLVFNYLFISNISFAHESKDIFLERFIEKFHPKYEKIDKNGYEIVFFEDYSDLNFLQLLLITCQTKDKSYFLNLKNHYLDFSQAYKSELEFLGQEYFNIVAPKQTNFLQDMMSGFLGGSK 98AFFDB4EA51B40F 98AFFDB4EA51B40F get3-get4-1 3 7 unspecified role unspecified role unspecified role unspecified role Region 1-54 Region 1-54 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role Region 11-290 Region 11-290 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 8 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association get4-get5-1 4 7 unspecified role unspecified role unspecified role unspecified role Region 1-54 Region 1-54 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role Region 11-290 Region 11-290 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction get3-1 6 8 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction get3-get4-2 1 7 unspecified role unspecified role unspecified role unspecified role Region 1-54 Region 1-54 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role Region 11-290 Region 11-290 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 8 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association get4-get3-1 5 9 unspecified role unspecified role bait bait Region 11-290 Region 11-290 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli 8 unspecified role unspecified role prey prey ecolx Escherichia coli physical association physical association get4-get5-2 2 7 unspecified role unspecified role unspecified role unspecified role Region 1-54 Region 1-54 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role Region 11-290 Region 11-290 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction