DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. PLoS biology 2014 imex curation MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. DIP original experiment: DIP-260673X PLoS biology 2014 IMEx Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. PLoS biology 2014 imex curation MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. DIP original experiment: DIP-260669X PLoS biology 2014 IMEx Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. PLoS biology 2014 imex curation MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. DIP original experiment: DIP-260659X PLoS biology 2014 IMEx Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. PLoS biology 2014 imex curation MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. DIP original experiment: DIP-260661X PLoS biology 2014 IMEx Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. PLoS biology 2014 imex curation MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. DIP original experiment: DIP-260664X PLoS biology 2014 IMEx Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. PLoS biology 2014 imex curation MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. DIP original experiment: DIP-260665X PLoS biology 2014 IMEx Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. PLoS biology 2014 imex curation MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. Only protein-protein interactions nicbe Nicotiana benthamiana anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. DIP original experiment: DIP-260678X PLoS biology 2014 IMEx Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. PLoS biology 2014 imex curation MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. DIP original experiment: DIP-260666X PLoS biology 2014 IMEx Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. PLoS biology 2014 imex curation MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. DIP original experiment: DIP-260670X PLoS biology 2014 IMEx Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. PLoS biology 2014 imex curation MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. DIP original experiment: DIP-260681X PLoS biology 2014 IMEx Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. PLoS biology 2014 imex curation MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. DIP original experiment: DIP-260674X PLoS biology 2014 IMEx Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. PLoS biology 2014 imex curation MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. DIP original experiment: DIP-260671X PLoS biology 2014 IMEx Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. PLoS biology 2014 imex curation MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. DIP original experiment: DIP-260663X PLoS biology 2014 IMEx Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. PLoS biology 2014 imex curation MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. DIP original experiment: DIP-260680X PLoS biology 2014 IMEx Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. PLoS biology 2014 imex curation MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. DIP original experiment: DIP-260662X PLoS biology 2014 IMEx Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. PLoS biology 2014 imex curation MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. DIP original experiment: DIP-260655X PLoS biology 2014 IMEx Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. PLoS biology 2014 imex curation MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. DIP original experiment: DIP-260657X PLoS biology 2014 IMEx Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. PLoS biology 2014 imex curation MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti tag coip anti tag coimmunoprecipitation anti tag coip de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. DIP original experiment: DIP-260676X PLoS biology 2014 IMEx Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. PLoS biology 2014 imex curation MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. DIP original experiment: DIP-260656X PLoS biology 2014 IMEx Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. PLoS biology 2014 imex curation MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. DIP original experiment: DIP-260660X PLoS biology 2014 IMEx Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. PLoS biology 2014 imex curation MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. DIP original experiment: DIP-260667X PLoS biology 2014 IMEx Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. PLoS biology 2014 imex curation MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. DIP original experiment: DIP-260675X PLoS biology 2014 IMEx Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. PLoS biology 2014 imex curation MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. Only protein-protein interactions nicbe Nicotiana benthamiana anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. DIP original experiment: DIP-260679X PLoS biology 2014 IMEx Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. PLoS biology 2014 imex curation MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. DIP original experiment: DIP-260658X PLoS biology 2014 IMEx Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. PLoS biology 2014 imex curation MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. DIP original experiment: DIP-260672X PLoS biology 2014 IMEx Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. PLoS biology 2014 imex curation MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. DIP original experiment: DIP-260668X PLoS biology 2014 IMEx Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. PLoS biology 2014 imex curation MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. Only protein-protein interactions nicbe Nicotiana benthamiana anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. DIP original experiment: DIP-260677X PLoS biology 2014 IMEx Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. ap1_arath Floral homeotic protein APETALA 1 Agamous-like MADS-box protein AGL7 AP1 AGL7 At1g69120 F4N2.9 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGRGRVQLKRIENKINRQVTFSKRRAGLLKKAHEISVLCDAEVALVVFSHKGKLFEYSTDSCMEKILERYERYSYAERQLIAPESDVNTNWSMEYNRLKAKIELLERNQRHYLGEDLQAMSPKELQNLEQQLDTALKHIRTRKNQLMYESINELQKKEKAIQEQNSMLSKQIKEREKILRAQQEQWDQQNQGHNMPPPLPPQQHQIQHPYMLSHQPSPFLNMGGLYQEDDPMAMRRNDLELTLEPVYNCNLGCFAA DIP protein P35631 original sequence version: 125 01E26DE18CE3478C cal_arath Transcription factor CAULIFLOWER Agamous-like MADS-box protein AGL10 CAL AGL10 At1g26310 F28B23.24 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGRGRVELKRIENKINRQVTFSKRRTGLLKKAQEISVLCDAEVSLIVFSHKGKLFEYSSESCMEKVLERYERYSYAERQLIAPDSHVNAQTNWSMEYSRLKAKIELLERNQRHYLGEELEPMSLKDLQNLEQQLETALKHIRSRKNQLMNESLNHLQRKEKEIQEENSMLTKQIKERENILRTKQTQCEQLNRSVDDVPQPQPFQHPHLYMIAHQTSPFLNMGGLYQEEDQTAMRRNNLDLTLEPIYNYLGCYAA DIP protein Q39081 original sequence version: 103 5F7313A804DF594D sep1_arath Developmental protein SEPALLATA 1 Agamous-like MADS-box protein AGL2 SEP1 AGL2 At5g15800 F14F8_180 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSNMLKTLDRYQKCSYGSIEVNNKPAKELENSYREYLKLKGRYENLQRQQRNLLGEDLGPLNSKELEQLERQLDGSLKQVRSIKTQYMLDQLSDLQNKEQMLLETNRALAMKLDDMIGVRSHHMGGGGGWEGGEQNVTYAHHQAQSQGLYQPLECNPTLQMGYDNPVCSEQITATTQAQAQQGNGYIPGWML DIP protein P29382 original sequence version: 112 867906D8D657621E q2njq2_aywbp SVM_signal domain-containing protein AYWB_224 protein protein aywbp Aster yellows witches'-broom phytoplasma (strain AYWB) MFKIKNNLLLLLNVFVFAFLGLFLINNNQQVMGMDKDIASTSNNNPNITNYSIEENIINLKYKIRENAVKKINIENEIQQLSNNEPRKNTLLTLKKNLENLINNQKEQLKTYQILLKTLNDENN DIP protein Q2NJQ2 original sequence version: 35 maf5_arath Protein MADS AFFECTING FLOWERING 5 MAF5 AGL68 FCL1 MADS box protein FCL1 MADS-box protein AGAMOUS-LIKE 68 F15O5.4 At5g65080 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGRRRVEIKRIENKSSRQVTFCKRRNGLMEKARQLSILCGSSVALFIVSSTGKLYNSSSGDSMAKIISRFKIQQADDPETLDLEDKTQDYLSHKELLEIVQRKIEEAKGDNVSIESLISMEEQLKSALSVIRARKTELLMELVKNLQDKEKLLKEKNKVLASEVGKLKKILETGDERAVMSPENSSGHSPPETLPLLK DIP protein Q683D7 original sequence version: 82 agl3_arath Agamous-like MADS-box protein AGL3 AGL3 Protein SEPALLATA 4 SEP4 F19B11.16 At2g03710 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEIALLIFSNRGKLYEFCSSPSGMARTVDKYRKHSYATMDPNQSAKDLQDKYQDYLKLKSRVEILQHSQRHLLGEELSEMDVNELEHLERQVDASLRQIRSTKARSMLDQLSDLKTKEEMLLETNRDLRRKLEDSDAALTQSFWGSSAAEQQQQHQQQQQGMSSYQSNPPIQEAGFFKPLQGNVALQMSSHYNHNPANATNSATTSQNVNGFFPGWMV DIP protein P29383 original sequence version: 120 A642CA7EA58AB38D rd23c_arath Ubiquitin receptor RAD23c RAD23C Putative DNA repair protein RAD23-3 RAD23 RAD23-3 RAD23-like protein 3 F16B3.17 At3g02540 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MKIFVKTLKGTHFEIEVKPEDSVVDVKKNIESVQGADVYPAAKQMLIHQGKVLKDETTIEENKVAENSFIVIMMNKSKPASAAASSASAGTSQAKSIPPSTSQPSISPQTPASVSAPVAPAPTRPPPPAPTPTPAPVAATETVTTPIPEPVPATISSSTPAPDSAPVGSQGDVYGQAASNLAAGSNLESTIQQILDMGGGTWDRETVVLALRAAFNNPERAVEYLYTGIPEQAEVPPVARPPASAGQPANPPAQTQQPAAAPASGPNANPLDLFPQGLPNVGGNPGAGTLDFLRNSQQFQALRAMVQANPQVLQPMLQELGKQNPNLMRLIQDHQADFLRLINEPVEGGGESGNLLGQMAAGMPQPQAIQVTHEEREAIERLEAMGFERALVLEVFFACNKNEELAANYLLDHMHEFEE DIP protein Q84L31 original sequence version: 86 CAA13BC4FFEB1E25 agl12_arath Agamous-like MADS-box protein AGL12 AGL12 Protein XAANTAL 1 XAL1 F14O23.5 F26A9.6 At1g71692 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MARGKIQLKRIENPVHRQVTFCKRRTGLLKKAKELSVLCDAEIGVVIFSPQGKLFELATKGTMEGMIDKYMKCTGGGRGSSSATFTAQEQLQPPNLDPKDEINVLKQEIEMLQKGISYMFGGGDGAMNLEELLLLEKHLEYWISQIRSAKMDVMLQEIQSLRNKEGVLKNTNKYLLEKIEENNNSILDANFAVMETNYSYPLTMPSEIFQF DIP protein Q38841 original sequence version: 111 B606BD2622043D5A agl6_arath Agamous-like MADS-box protein AGL6 AGL6 At2g45650 F17K2.18 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGRGRVEMKRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFGSVGIESTIERYNRCYNCSLSNNKPEETTQSWCQEVTKLKSKYESLVRTNRNLLGEDLGEMGVKELQALERQLEAALTATRQRKTQVMMEEMEDLRKKERQLGDINKQLKIKFETEGHAFKTFQDLWANSAASVAGDPNNSEFPVEPSHPNVLDCNTEPFLQIGFQQHYYVQGEGSSVSKSNVAGETNFVQGWVL DIP protein P29386 original sequence version: 108 F763A4A71515CF20 q9at76-1 Agamous-like MADS-box protein AGL27 AGL27 FK1 FLM MAF1 MADS box FLC1-like nuclear protein Protein FLOWERING LOCUS M Protein MADS AFFECTING FLOWERING 1 F22K20.15 At1g77080 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGRRKIEIKRIENKSSRQVTFSKRRNGLIDKARQLSILCESSVAVVVVSASGKLYDSSSGDDISKIIDRYEIQHADELRALDLEEKIQNYLPHKELLETVQSKLEEPNVDNVSVDSLISLEEQLETALSVSRARKAELMMEYIESLKEKEKLLREENQVLASQMGKNTLLATDDERGMFPGSSSGNKIPETLPLLN DIP protein Q9AT76-1 original sequence version: 103 DIP protein Q9AT76 original sequence version: 96 q7x9h6_arath AGL79 AGAMOUS-like 79 At3g30260 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGRGRVQLRRIENKIRRQVTFSKRRTGLVKKAQEISVLCDAEVALIVFSPKGKLFEYSAGSSMERILDRYERSAYAGQDIPTPNLDSQGECSTECSKLLRMIDVLQRSLRHLRGEEVDGLSIRDLQGVEMQLDTALKKTRSRKNQLMVESIAQLQKKEKELKELKKQLTKKAGEREDFQTQNLSHDLASLATPPFESPHELRRTISPPPPPLSSGDTSQRDGVGEVAAGTLIRRTNATLPHWMPQLTGE DIP protein Q7X9H6 original sequence version: null DIP protein Q7X9H6 original sequence version: 85 18652A3792C707A0 agl8_arath Agamous-like MADS-box protein AGL8 Floral homeotic protein AGL8 Transcription factor FRUITFULL AGL8 FUL At5g60910 MSL3.3 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGRGRVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSSKGKLFEYSTDSCMERILERYDRYLYSDKQLVGRDVSQSENWVLEHAKLKARVEVLEKNKRNFMGEDLDSLSLKELQSLEHQLDAAIKSIRSRKNQAMFESISALQKKDKALQDHNNSLLKKIKEREKKTGQQEGQLVQCSNSSSVLLPQYCVTSSRDGFVERVGGENGGASSLTEPNSLLPAWMLRPTTTNE DIP protein Q38876 original sequence version: 120 516499731EADB2D2 agl14_arath Agamous-like MADS-box protein AGL14 AGL14 Protein XAANTAL 2 XAL2 T26M18.90 At4g11880 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MVRGKTEMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSPRGKLYEFSSSSSIPKTVERYQKRIQDLGSNHKRNDNSQQSKDETYGLARKIEHLEISTRKMMGEGLDASSIEELQQLENQLDRSLMKIRAKKYQLLREETEKLKEKERNLIAENKMLMEKCEMQGRGIIGRISSSSSTSELDIDDNEMEVVTDLFIGPPETRHFKKFPPSN DIP protein Q38838 original sequence version: 114 E876DAEA049B125E sep2_arath Developmental protein SEPALLATA 2 Agamous-like MADS-box protein AGL4 SEP2 AGL4 At3g02310 F14P3.4 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVSLIVFSNRGKLYEFCSTSNMLKTLERYQKCSYGSIEVNNKPAKELENSYREYLKLKGRYENLQRQQRNLLGEDLGPLNSKELEQLERQLDGSLKQVRCIKTQYMLDQLSDLQGKEHILLDANRALSMKLEDMIGVRHHHIGGGWEGGDQQNIAYGHPQAHSQGLYQSLECDPTLQIGYSHPVCSEQMAVTVQGQSQQGNGYIPGWML DIP protein P29384 original sequence version: 107 53136FE263389943 soc1_arath MADS-box protein SOC1 Protein SUPPRESSOR OF CONSTANS OVEREXPRESSION 1 Agamous-like MADS-box protein AGL20 SOC1 AGL20 At2g45660 F17K2.19 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MVRGKTQMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVSLIIFSPKGKLYEFASSNMQDTIDRYLRHTKDRVSTKPVSEENMQHLKYEAANMMKKIEQLEASKRKLLGEGIGTCSIEELQQIEQQLEKSVKCIRARKTQVFKEQIEQLKQKEKALAAENEKLSEKWGSHESEVWSNKNQESTGRGDEESSPSSEVETQLFIGLPCSSRK DIP protein O64645 original sequence version: 113 B4D39151DE541F8D flc_arath MADS-box protein FLOWERING LOCUS C FLC FLF MADS-box protein FLOWERING LOCUS F T31P16.130 At5g10140 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGRKKLEIKRIENKSSRQVTFSKRRNGLIEKARQLSVLCDASVALLVVSASGKLYSFSSGDNLVKILDRYGKQHADDLKALDHQSKALNYGSHYELLELVDSKLVGSNVKNVSIDALVQLEEHLETALSVTRAKKTELMLKLVENLKEKEKMLKEENQVLASQMENNHHVGAEAEMEMSPAGQISDNLPVTLPLLN DIP protein Q9S7Q7 original sequence version: 93 DIP protein Q9S7Q7 original sequence version: 106 656085A2B157FF42 rd23d_arath Ubiquitin receptor RAD23d RAD23D Putative DNA repair protein RAD23-4 RAD23 RAD23-4 RAD23-like protein 4 MXI10.20 At5g38470 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MKIFVKTLSGSNFEIEVKPADKVSDVKTAIETVKGAEYPAAKQMLIHQGKVLKDETTLEENNVVENSFIVIMLSKTKASPSGASTASAPAPSATQPQTVATPQVSAPTASVPVPTSGTATAAAPATAASVQTDVYGQAASNLVAGTTLESTVQQILDMGGGSWDRDTVVRALRAAFNNPERAVEYLYSGIPAQAEIPPVAQAPATGEQAANPLAQPQQAAAPAAATGGPNANPLNLFPQGMPAADAGAGAGNLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLVRLIQEHQADFLRLINEPVEGEENVMEQLEAAMPQAVTVTPEEREAIERLEGMGFDRAMVLEVFFACNKNEELAANYLLDHMHEFEDQ DIP protein Q84L30 original sequence version: 90 DD9B59153EA3E6A9 sep3_arath Developmental protein SEPALLATA 3 Agamous-like MADS-box protein AGL9 SEP3 AGL9 At1g24260 F3I6.19 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLRTLERYQKCNYGAPEPNVPSREALAVELSSQQEYLKLKERYDALQRTQRNLLGEDLGPLSTKELESLERQLDSSLKQIRALRTQFMLDQLNDLQSKERMLTETNKTLRLRLADGYQMPLQLNPNQEEVDHYGRHHHQQQQHSQAFFQPLECEPILQIGYQGQQDGMGAGPSVNNYMLGWLPYDTNSI DIP protein O22456 original sequence version: 117 DIP protein O22456 original sequence version: 110 0057CABD3F1AFC40 q2njq2_aywbp-sep3-1 16 45 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 31 unspecified role unspecified role bait bait Region 34-124 Region 34-124 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association q2njq2_aywbp-ap1-1 6 28 unspecified role unspecified role prey prey Region 87-178 Region 87-178 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 31 unspecified role unspecified role bait bait Region 34-124 Region 34-124 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association q2njq2_aywbp-agl8-1 5 39 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 31 unspecified role unspecified role bait bait Region 34-124 Region 34-124 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association sep3-q2njq2_aywbp-1 22 31 unspecified role unspecified role prey prey arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 45 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association q2njq2_aywbp-agl12-1 19 35 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 31 unspecified role unspecified role bait bait Region 34-124 Region 34-124 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association q2njq2_aywbp-flc-1 1 43 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 31 unspecified role unspecified role bait bait Region 34-124 Region 34-124 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association q2njq2_aywbp-rad23d-1 10 44 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 31 unspecified role unspecified role bait bait Region 34-124 Region 34-124 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association q2njq2_aywbp-cal-1 8 29 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 31 unspecified role unspecified role bait bait Region 34-124 Region 34-124 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association q2njq2_aywbp-rad23c-1 14 34 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 31 unspecified role unspecified role bait bait Region 34-124 Region 34-124 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association q2njq2_aywbp-maf5-1 11 32 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 31 unspecified role unspecified role bait bait Region 34-124 Region 34-124 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association q2njq2_aywbp-agl27-1 17 37 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 31 unspecified role unspecified role bait bait Region 34-124 Region 34-124 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association q2njq2_aywbp-agl6-1 21 36 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 31 unspecified role unspecified role bait bait Region 34-124 Region 34-124 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association q2njq2_aywbp-rad23c-2 24 34 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 31 unspecified role unspecified role bait bait Region 34-124 Region 34-124 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association q2njq2_aywbp-agl3-1 26 33 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 31 unspecified role unspecified role bait bait Region 34-124 Region 34-124 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association q2njq2_aywbp-rad23d-2 3 44 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 31 unspecified role unspecified role bait bait Region34-124 Region34-124 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association q2njq2_aywbp-agl27-2 18 30 unspecified role unspecified role prey prey arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 41 unspecified role unspecified role prey prey arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 28 unspecified role unspecified role prey prey arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 37 unspecified role unspecified role prey prey arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 42 unspecified role unspecified role prey prey arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 31 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Region 34-124 Region 34-124 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress association association q2njq2_aywbp-sep2-1 2 41 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 31 unspecified role unspecified role bait bait Region 34-124 Region 34-124 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association q2njq2_aywbp-sep3-2 7 45 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range nicbe Nicotiana benthamiana 31 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Region 34-124 Region 34-124 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain nicbe Nicotiana benthamiana physical association physical association q2njq2_aywbp-sep3-3 20 45 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 31 unspecified role unspecified role bait bait Region 34-124 Region 34-124 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association q2njq2_aywbp-agl27-3 4 37 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 31 unspecified role unspecified role bait bait Region 34-124 Region 34-124 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association q2njq2_aywbp-sep1-1 9 30 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 31 unspecified role unspecified role bait bait Region 34-124 Region 34-124 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association q2njq2_aywbp-ap1-2 27 28 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range nicbe Nicotiana benthamiana 31 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Region 34-124 Region 34-124 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain nicbe Nicotiana benthamiana physical association physical association q2njq2_aywbp-agl12-2 15 35 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 31 unspecified role unspecified role bait bait Region 34-124 Region 34-124 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association q2njq2_aywbp-agl14-1 12 40 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 31 unspecified role unspecified role bait bait Region 34-124 Region 34-124 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association q2njq2_aywbp-agl79-1 13 38 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 31 unspecified role unspecified role bait bait Region 34-124 Region 34-124 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association q2njq2_aywbp-soc1-1 23 42 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range nicbe Nicotiana benthamiana 31 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Region 34-124 Region 34-124 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain nicbe Nicotiana benthamiana physical association physical association q2njq2_aywbp-soc1-2 25 42 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 31 unspecified role unspecified role bait bait Region 34-124 Region 34-124 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association