DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu SRP RNA remodeling by SRP68 explains its role in protein translocation. SRP RNA remodeling by SRP68 explains its role in protein translocation. Science (New York, N.Y.) 2014 imex curation Grotwinkel JT., Wild K., Segnitz B., Sinning I. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Grotwinkel JT., Wild K., Segnitz B., Sinning I. DIP original experiment: DIP-264647X Science (New York, N.Y.) 2014 IMEx SRP RNA remodeling by SRP68 explains its role in protein translocation. SRP RNA remodeling by SRP68 explains its role in protein translocation. SRP RNA remodeling by SRP68 explains its role in protein translocation. Science (New York, N.Y.) 2014 imex curation Grotwinkel JT., Wild K., Segnitz B., Sinning I. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Grotwinkel JT., Wild K., Segnitz B., Sinning I. DIP original experiment: DIP-264645X Science (New York, N.Y.) 2014 IMEx SRP RNA remodeling by SRP68 explains its role in protein translocation. SRP RNA remodeling by SRP68 explains its role in protein translocation. SRP RNA remodeling by SRP68 explains its role in protein translocation. Science (New York, N.Y.) 2014 imex curation Grotwinkel JT., Wild K., Segnitz B., Sinning I. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Grotwinkel JT., Wild K., Segnitz B., Sinning I. DIP original experiment: DIP-264648X Science (New York, N.Y.) 2014 IMEx SRP RNA remodeling by SRP68 explains its role in protein translocation. SRP RNA remodeling by SRP68 explains its role in protein translocation. SRP RNA remodeling by SRP68 explains its role in protein translocation. Science (New York, N.Y.) 2014 imex curation Grotwinkel JT., Wild K., Segnitz B., Sinning I. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Grotwinkel JT., Wild K., Segnitz B., Sinning I. DIP original experiment: DIP-264646X Science (New York, N.Y.) 2014 IMEx SRP RNA remodeling by SRP68 explains its role in protein translocation. srp68_human Signal recognition particle subunit SRP68 SRP68 Signal recognition particle 68 kDa protein protein protein human Homo sapiens Human MAAEKQVPGGGGGGGSGGGGGSGGGGSGGGRGAGGEENKENERPSAGSKANKEFGDSLSLEILQIIKESQQQHGLRHGDFQRYRGYCSRRQRRLRKTLNFKMGNRHKFTGKKVTEELLTDNRYLLLVLMDAERAWSYAMQLKQEANTEPRKRFHLLSRLRKAVKHAEELERLCESNRVDAKTKLEAQAYTAYLSGMLRFEHQEWKAAIEAFNKCKTIYEKLASAFTEEQAVLYNQRVEEISPNIRYCAYNIGDQSAINELMQMRLRSGGTEGLLAEKLEALITQTRAKQAATMSEVEWRGRTVPVKIDKVRIFLLGLADNEAAIVQAESEETKERLFESMLSECRDAIQVVREELKPDQKQRDYILEGEPGKVSNLQYLHSYLTYIKLSTAIKRNENMAKGLQRALLQQQPEDDSKRSPRPQDLIRLYDIILQNLVELLQLPGLEEDKAFQKEIGLKTLVFKAYRCFFIAQSYVLVKKWSEALVLYDRVLKYANEVNSDAGAFKNSLKDLPDVQELITQVRSEKCSLQAAAILDANDAHQTETSSSQVKDNKPLVERFETFCLDPSLVTKQANLVHFPPGFQPIPCKPLFFDLALNHVAFPPLEDKLEQKTKSGLTGYIKGIFGFRS DIP protein Q9UHB9 original sequence version: 126 6EF582892D300B2D srp19_human Signal recognition particle 19 kDa protein SRP19 protein protein human Homo sapiens Human MACAAARSPADQDRFICIYPAYLNNKKTIAEGRRIPISKAVENPTATEIQDVCSAVGLNVFLEKNKMYSREWNRDVQYRGRVRVQLKQEDGSLCLVQFPSRKSVMLYAAEMIPKLKTRTQKTGGADQSLQQGEGSKKGKGKKKK DIP protein P09132 original sequence version: 180 DIP protein P09132 original sequence version: 159 E25F661972338CAE g0s5v2_chatd Signal recognition particle subunit SRP68 CTHT_0033730 protein protein chatd Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) MDITKFVVTSREKALLYGDYATYRTQLSGKLLNCRKKLNIATKNRGKFHPKTAITPEQIAENTEYVRLQLLTAERAWAHAMAMKAAHSANTKGMTGRTRSHIVSRLEKGARIAEKLAQALSDGASGASPTDILDARAYAALLRGAALFEKQNWGACLKSYAICRIIYTALATSSKGDIFKELLSDTIDPSMRFAAYQAKIPRTLPIATIAHRAFEQSDAELVDSIKTLNPAILEQGDIKERKAAEGAPTTLTWRGRQVKIEDAVISAAWGAVDTVKEQLAQKLASSSSLRPKEMAAAYDDILIASQDAVDATKQAIDELKAEGVAPSDPRMQSLQITRTAVNYEMISWRIGRNRVLAGERDGAKLDLGAGSKQKKGQTDASSTERRKYETPGRQIARLKEKVVLYDGILQNVESIKELPGIANDEELSARLDATSKYFTALKSLAISRSHAIAGNAVNALALIKHGYSLCHAVLPVLNQQAPDETDGFSPRNIAITKQDLSFLHDTMSGELHRARALVEIFSKLPTPPYEPSTTSQQPLSARLSEYPSTGDVDLSNIVSYPPRLETFPVKPLFLDVAWNYIEYPDKSRAGQQAEKKQVSTEADQQKAAASEPEPAPKPQKRGWFSFGR DIP protein G0S5V2 original sequence version: 13 srp68-1 1 5 unspecified role unspecified role unspecified role unspecified role Region 47-254 Region 47-254 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction srp19-srp68-1 2 5 unspecified role unspecified role unspecified role unspecified role Region 47-254 Region 47-254 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 6 unspecified role unspecified role unspecified role unspecified role Region 1-120 Region 1-120 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association g0s5v2_chatd-1 3 7 unspecified role unspecified role unspecified role unspecified role Region 1-217 Region 1-217 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction srp19-srp68-2 4 5 unspecified role unspecified role unspecified role unspecified role Region 47-254 Region 47-254 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 6 unspecified role unspecified role unspecified role unspecified role Region 1-120 Region 1-120 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association