IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ SAP facilitates recruitment and activation of LCK at NTB-A receptors during restimulation-induced cell death. SAP facilitates recruitment and activation of LCK at NTB-A receptors during restimulation-induced cell death. Journal of immunology (Baltimore, Md. : 1950) 2014 imex curation Katz G., Krummey SM., Larsen SE., Stinson JR., Snow AL. T cells were activated with either anti-CD3-epsilon and anti-CD28 or OKT3 mAb and IL2 or mitogens PHA or Concanavalin A. andrew.snow@usuhs.edu 14-Jul-2017: Contacted by IntAct-Help. Only protein-protein interactions human-peer Human Peer T lymphocytes peer Human Peer T lymphocytes http://www.dsmz.de/human_and_animal_cell_lines/info.php?dsmz_nr=6&from=cell_line_index&select=search_for_term&term=peer&preselect=human&firstload=0 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Katz G., Krummey SM., Larsen SE., Stinson JR., Snow AL. PEER is a NTB-A–negative T cell line, stably transfected with WT NTB-A and mutants. Cells were restimulated with OKT3, an anti-CD3-epsilon antibody. T cells were activated with either anti-CD3-epsilon and anti-CD28 or OKT3 mAb and IL2 or mitogens PHA or Concanavalin A. andrew.snow@usuhs.edu Accepted 2017-JUN-13 AT 09:55 BST AT 09:55 BST by ORCHARD Journal of immunology (Baltimore, Md. : 1950) 2014 imex curation SAP facilitates recruitment and activation of LCK at NTB-A receptors during restimulation-induced cell death. SAP facilitates recruitment and activation of LCK at NTB-A receptors during restimulation-induced cell death. Journal of immunology (Baltimore, Md. : 1950) 2014 imex curation Katz G., Krummey SM., Larsen SE., Stinson JR., Snow AL. T cells were activated with either anti-CD3-epsilon and anti-CD28 or OKT3 mAb and IL2 or mitogens PHA or Concanavalin A. andrew.snow@usuhs.edu 14-Jul-2017: Contacted by IntAct-Help. Only protein-protein interactions human-t-cell Homo sapiens t-cell Peripheral blood T-lymphocytes anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Katz G., Krummey SM., Larsen SE., Stinson JR., Snow AL. T cells were activated with either anti-CD3-epsilon and anti-CD28 or OKT3 mAb and IL2 or mitogens PHA or Concanavalin A. andrew.snow@usuhs.edu Accepted 2017-JUN-13 AT 09:55 BST AT 09:55 BST by ORCHARD Journal of immunology (Baltimore, Md. : 1950) 2014 imex curation sh21a_human SH2 domain-containing protein 1A SH2D1A DSHP SAP Signaling lymphocytic activation molecule-associated protein T-cell signal transduction molecule SAP Duncan disease SH2-protein protein protein human Homo sapiens Human MDAVAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTETGSWSAETAPGVHKRYFRKIKNLISAFQKPDQGIVIPLQYPVEKKSSARSTQGTTGIREDPDVCLKAP mint Inhibitor of the SLAM self-association. Acts by blocking recruitment of the SH2-domain-containing signal-transduction molecule SHP-2 to a docking site in the slam cytoplasmic region Defects in SH2D1A are a cause of lymphoproliferative syndrome X-linked type 1 (XLP1) [MIM:308240]; also known as X-linked lymphoproliferative disease (XLPD) or Duncan disease. XLP is a rare immunodeficiency characterized by extreme susceptibility to infection with Epstein-Barr virus (EBV). Symptoms include severe or fatal mononucleosis, acquired hypogammaglobulinemia, pancytopenia and malignant lymphoma 90234E7A6614EE3D q96du3-2 SLAM family member 6 SLAMF6 KALI Activating NK receptor NK-T-B-antigen UNQ6123/PRO20080 protein protein human Homo sapiens Human MLWLFQSLLFVFCFGPGNVVSQSSLTPLMVNGILGESVTLPLEFPAGEKVNFITWLFNETSLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSLQLSNLKMEDTGSYRAQISTKTSAKLSSYTLRILRQLRNIQVTNHSQLFQNMTCELHLTCSVEDADDNVSFRWEALGNTLSSQPNLTVSWDPRISSEQDYTCIAENAVSNLSFSVSAQKLCEDVKIQYTDTKMILFMVSGICIVFGFIILLLLVLRKRRDSLSLSTQRTQGPESARNLEYVSVSPTNNTVYASVTHSNRETEIWTPRENDTITIYSTINHSKESKPTFSRATALDNVV 16E2727CEF8306F4 lck_human Tyrosine-protein kinase Lck Protein YT16 Proto-oncogene Lck T cell-specific protein-tyrosine kinase LCK Lymphocyte cell-specific protein-tyrosine kinase p56-LCK Leukocyte C-terminal Src kinase protein protein human Homo sapiens Human MGCGCSSHPEDDWMENIDVCENCHYPIVPLDGKGTLLIRNGSEVRDPLVTYEGSNPPASPLQDNLVIALHSYEPSHDGDLGFEKGEQLRILEQSGEWWKAQSLTTGQEGFIPFNFVAKANSLEPEPWFFKNLSRKDAERQLLAPGNTHGSFLIRESESTAGSFSLSVRDFDQNQGEVVKHYKIRNLDNGGFYISPRITFPGLHELVRHYTNASDGLCTRLSRPCQTQKPQKPWWEDEWEVPRETLKLVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDAFLAEANLMKQLQHQRLVRLYAVVTQEPIYIITEYMENGSLVDFLKTPSGIKLTINKLLDMAAQIAEGMAFIEERNYIHRDLRAANILVSDTLSCKIADFGLARLIEDNEYTAREGAKFPIKWTAPEAINYGTFTIKSDVWSFGILLTEIVTHGRIPYPGMTNPEVIQNLERGYRMVRPDNCPEELYQLMRLCWKERPEDRPTFDYLRSVLEDFFTATEGQYQPQP DIP protein P06239 original sequence version: 164 DIP protein P06239-1 original sequence version: 193 44BFF0D43FFB420D slaf6_human SLAM family member 6 KALI SLAMF6 Activating NK receptor NK-T-B-antigen UNQ6123/PRO20080 protein protein human Homo sapiens Human MLWLFQSLLFVFCFGPGNVVSQSSLTPLMVNGILGESVTLPLEFPAGEKVNFITWLFNETSLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSLQLSNLKMEDTGSYRAQISTKTSAKLSSYTLRILRQLRNIQVTNHSQLFQNMTCELHLTCSVEDADDNVSFRWEALGNTLSSQPNLTVSWDPRISSEQDYTCIAENAVSNLSFSVSAQKLCEDVKIQYTDTKMILFMVSGICIVFGFIILLLLVLRKRRDSLSLSTQRTQGPAESARNLEYVSVSPTNNTVYASVTHSNRETEIWTPRENDTITIYSTINHSKESKPTFSRATALDNVV 46D8141A0D198091 slamf6-lck-2 2 5 unspecified role unspecified role prey prey tyr394 optyr O4'-phospho-L-tyrosine (2S)-2-amino-3-(4-phosphonooxyphenyl)propanoic acid 2-azanyl-3-(4-phosphonooxyphenyl)propanoic acid MOD_RES Phosphotyrosine O4-phosphotyrosine tyrosine phosphate 2-amino-3-(4-hydroxyphenyl)propanoic acid 4'-phosphate O4'-phospho-L-tyrosine O4'-phosphorylated L-tyrosine OPTyr Phospho Phospho Tyrosinyl Phosphorylation phosphorylationy certain certain sequence position certain certain certain sequence position certain observed-ptm observed-ptm observed ptm observed-ptm 6 unspecified role unspecified role bait bait physical association physical association 1C, 2A, 3A OKT3 LCK was associated with NTB-A, and this association was further increased during restimulation. There was no increase in LCK association with NTB-A, in XLP patient T cells compared with normal control T cells and Y394 phosphorylation of NTB-A–bound LCK was reduced. slamf6-lck-1 2 3 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey 6 unspecified role unspecified role prey prey association association 1D OKT3 psap-lck-1 2 3 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait association association Supp fig 2 OKT3 slamf6-lck-3 1 3 unspecified role unspecified role prey prey 5 unspecified role unspecified role prey prey tyr394 optyr O4'-phospho-L-tyrosine (2S)-2-amino-3-(4-phosphonooxyphenyl)propanoic acid 2-azanyl-3-(4-phosphonooxyphenyl)propanoic acid MOD_RES Phosphotyrosine O4-phosphotyrosine tyrosine phosphate 2-amino-3-(4-hydroxyphenyl)propanoic acid 4'-phosphate O4'-phospho-L-tyrosine O4'-phosphorylated L-tyrosine OPTyr Phospho Phospho Tyrosinyl Phosphorylation phosphorylationy certain certain sequence position certain certain certain sequence position certain observed-ptm observed-ptm observed ptm observed-ptm 4 unspecified role unspecified role bait bait Q96DU3-2:p.Tyr308Phe mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain Y F Wed May 02 15:02:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr308phe' Tue Jun 30 17:48:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr308Phe' Q96DU3-2:p.Tyr273Phe mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain Y F Wed May 02 20:30:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr273phe' Tue Jun 30 17:39:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr273Phe' tail_region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain Q96DU3-2:p.Tyr284Phe mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain Y F Wed May 02 18:39:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr284phe' Tue Jun 30 17:02:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr284Phe' c_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range association association 4C OKT3 After TCR restimulation, both recruitment and Y394 phosphorylation of LCK were detected; the NTB-A Y273F mutation resulted in significantly enhanced LCK recruitment and phosphorylation, whereas both Y284F and Y308F mutations independently abolished recruitment and Y394 phosphorylation of LCK. after TCR restimulation, both recruitment and Y394 phosphorylation of LCK were detected. the Y273F mutation resulted in significantly enhanced LCK recruitment and phosphorylation