DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Cell-cycle-regulated activation of Akt kinase by phosphorylation at its carboxyl terminus. Cell-cycle-regulated activation of Akt kinase by phosphorylation at its carboxyl terminus. Nature 2014 imex curation Liu P., Begley M., Michowski W., Inuzuka H., Ginzberg M., Gao D., Tsou P., Gan W., Papa A., Kim BM., Wan L., Singh A., Zhai B., Yuan M., Wang Z., Gygi SP., Lee TH., Lu KP., Toker A., Pandolfi PP., Asara JM., Kirschner MW., Sicinski P., Cantley L., Wei W. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Liu P., Begley M., Michowski W., Inuzuka H., Ginzberg M., Gao D., Tsou P., Gan W., Papa A., Kim BM., Wan L., Singh A., Zhai B., Yuan M., Wang Z., Gygi SP., Lee TH., Lu KP., Toker A., Pandolfi PP., Asara JM., Kirschner MW., Sicinski P., Cantley L., Wei W. DIP original experiment: DIP-260758X Nature 2014 IMEx Cell-cycle-regulated activation of Akt kinase by phosphorylation at its carboxyl terminus. Cell-cycle-regulated activation of Akt kinase by phosphorylation at its carboxyl terminus. Cell-cycle-regulated activation of Akt kinase by phosphorylation at its carboxyl terminus. Nature 2014 imex curation Liu P., Begley M., Michowski W., Inuzuka H., Ginzberg M., Gao D., Tsou P., Gan W., Papa A., Kim BM., Wan L., Singh A., Zhai B., Yuan M., Wang Z., Gygi SP., Lee TH., Lu KP., Toker A., Pandolfi PP., Asara JM., Kirschner MW., Sicinski P., Cantley L., Wei W. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Liu P., Begley M., Michowski W., Inuzuka H., Ginzberg M., Gao D., Tsou P., Gan W., Papa A., Kim BM., Wan L., Singh A., Zhai B., Yuan M., Wang Z., Gygi SP., Lee TH., Lu KP., Toker A., Pandolfi PP., Asara JM., Kirschner MW., Sicinski P., Cantley L., Wei W. DIP original experiment: DIP-260764X Nature 2014 IMEx Cell-cycle-regulated activation of Akt kinase by phosphorylation at its carboxyl terminus. Cell-cycle-regulated activation of Akt kinase by phosphorylation at its carboxyl terminus. Cell-cycle-regulated activation of Akt kinase by phosphorylation at its carboxyl terminus. Nature 2014 imex curation Liu P., Begley M., Michowski W., Inuzuka H., Ginzberg M., Gao D., Tsou P., Gan W., Papa A., Kim BM., Wan L., Singh A., Zhai B., Yuan M., Wang Z., Gygi SP., Lee TH., Lu KP., Toker A., Pandolfi PP., Asara JM., Kirschner MW., Sicinski P., Cantley L., Wei W. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Liu P., Begley M., Michowski W., Inuzuka H., Ginzberg M., Gao D., Tsou P., Gan W., Papa A., Kim BM., Wan L., Singh A., Zhai B., Yuan M., Wang Z., Gygi SP., Lee TH., Lu KP., Toker A., Pandolfi PP., Asara JM., Kirschner MW., Sicinski P., Cantley L., Wei W. DIP original experiment: DIP-260761X Nature 2014 IMEx Cell-cycle-regulated activation of Akt kinase by phosphorylation at its carboxyl terminus. Cell-cycle-regulated activation of Akt kinase by phosphorylation at its carboxyl terminus. Cell-cycle-regulated activation of Akt kinase by phosphorylation at its carboxyl terminus. Nature 2014 imex curation Liu P., Begley M., Michowski W., Inuzuka H., Ginzberg M., Gao D., Tsou P., Gan W., Papa A., Kim BM., Wan L., Singh A., Zhai B., Yuan M., Wang Z., Gygi SP., Lee TH., Lu KP., Toker A., Pandolfi PP., Asara JM., Kirschner MW., Sicinski P., Cantley L., Wei W. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Liu P., Begley M., Michowski W., Inuzuka H., Ginzberg M., Gao D., Tsou P., Gan W., Papa A., Kim BM., Wan L., Singh A., Zhai B., Yuan M., Wang Z., Gygi SP., Lee TH., Lu KP., Toker A., Pandolfi PP., Asara JM., Kirschner MW., Sicinski P., Cantley L., Wei W. DIP original experiment: DIP-260759X Nature 2014 IMEx Cell-cycle-regulated activation of Akt kinase by phosphorylation at its carboxyl terminus. Cell-cycle-regulated activation of Akt kinase by phosphorylation at its carboxyl terminus. Cell-cycle-regulated activation of Akt kinase by phosphorylation at its carboxyl terminus. Nature 2014 imex curation Liu P., Begley M., Michowski W., Inuzuka H., Ginzberg M., Gao D., Tsou P., Gan W., Papa A., Kim BM., Wan L., Singh A., Zhai B., Yuan M., Wang Z., Gygi SP., Lee TH., Lu KP., Toker A., Pandolfi PP., Asara JM., Kirschner MW., Sicinski P., Cantley L., Wei W. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Liu P., Begley M., Michowski W., Inuzuka H., Ginzberg M., Gao D., Tsou P., Gan W., Papa A., Kim BM., Wan L., Singh A., Zhai B., Yuan M., Wang Z., Gygi SP., Lee TH., Lu KP., Toker A., Pandolfi PP., Asara JM., Kirschner MW., Sicinski P., Cantley L., Wei W. DIP original experiment: DIP-260760X Nature 2014 IMEx Cell-cycle-regulated activation of Akt kinase by phosphorylation at its carboxyl terminus. Cell-cycle-regulated activation of Akt kinase by phosphorylation at its carboxyl terminus. Cell-cycle-regulated activation of Akt kinase by phosphorylation at its carboxyl terminus. Nature 2014 imex curation Liu P., Begley M., Michowski W., Inuzuka H., Ginzberg M., Gao D., Tsou P., Gan W., Papa A., Kim BM., Wan L., Singh A., Zhai B., Yuan M., Wang Z., Gygi SP., Lee TH., Lu KP., Toker A., Pandolfi PP., Asara JM., Kirschner MW., Sicinski P., Cantley L., Wei W. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Liu P., Begley M., Michowski W., Inuzuka H., Ginzberg M., Gao D., Tsou P., Gan W., Papa A., Kim BM., Wan L., Singh A., Zhai B., Yuan M., Wang Z., Gygi SP., Lee TH., Lu KP., Toker A., Pandolfi PP., Asara JM., Kirschner MW., Sicinski P., Cantley L., Wei W. DIP original experiment: DIP-260762X Nature 2014 IMEx Cell-cycle-regulated activation of Akt kinase by phosphorylation at its carboxyl terminus. Cell-cycle-regulated activation of Akt kinase by phosphorylation at its carboxyl terminus. Cell-cycle-regulated activation of Akt kinase by phosphorylation at its carboxyl terminus. Nature 2014 imex curation Liu P., Begley M., Michowski W., Inuzuka H., Ginzberg M., Gao D., Tsou P., Gan W., Papa A., Kim BM., Wan L., Singh A., Zhai B., Yuan M., Wang Z., Gygi SP., Lee TH., Lu KP., Toker A., Pandolfi PP., Asara JM., Kirschner MW., Sicinski P., Cantley L., Wei W. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Liu P., Begley M., Michowski W., Inuzuka H., Ginzberg M., Gao D., Tsou P., Gan W., Papa A., Kim BM., Wan L., Singh A., Zhai B., Yuan M., Wang Z., Gygi SP., Lee TH., Lu KP., Toker A., Pandolfi PP., Asara JM., Kirschner MW., Sicinski P., Cantley L., Wei W. DIP original experiment: DIP-260757X Nature 2014 IMEx Cell-cycle-regulated activation of Akt kinase by phosphorylation at its carboxyl terminus. Cell-cycle-regulated activation of Akt kinase by phosphorylation at its carboxyl terminus. Cell-cycle-regulated activation of Akt kinase by phosphorylation at its carboxyl terminus. Nature 2014 imex curation Liu P., Begley M., Michowski W., Inuzuka H., Ginzberg M., Gao D., Tsou P., Gan W., Papa A., Kim BM., Wan L., Singh A., Zhai B., Yuan M., Wang Z., Gygi SP., Lee TH., Lu KP., Toker A., Pandolfi PP., Asara JM., Kirschner MW., Sicinski P., Cantley L., Wei W. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Liu P., Begley M., Michowski W., Inuzuka H., Ginzberg M., Gao D., Tsou P., Gan W., Papa A., Kim BM., Wan L., Singh A., Zhai B., Yuan M., Wang Z., Gygi SP., Lee TH., Lu KP., Toker A., Pandolfi PP., Asara JM., Kirschner MW., Sicinski P., Cantley L., Wei W. DIP original experiment: DIP-260763X Nature 2014 IMEx Cell-cycle-regulated activation of Akt kinase by phosphorylation at its carboxyl terminus. Cell-cycle-regulated activation of Akt kinase by phosphorylation at its carboxyl terminus. Cell-cycle-regulated activation of Akt kinase by phosphorylation at its carboxyl terminus. Nature 2014 imex curation Liu P., Begley M., Michowski W., Inuzuka H., Ginzberg M., Gao D., Tsou P., Gan W., Papa A., Kim BM., Wan L., Singh A., Zhai B., Yuan M., Wang Z., Gygi SP., Lee TH., Lu KP., Toker A., Pandolfi PP., Asara JM., Kirschner MW., Sicinski P., Cantley L., Wei W. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Liu P., Begley M., Michowski W., Inuzuka H., Ginzberg M., Gao D., Tsou P., Gan W., Papa A., Kim BM., Wan L., Singh A., Zhai B., Yuan M., Wang Z., Gygi SP., Lee TH., Lu KP., Toker A., Pandolfi PP., Asara JM., Kirschner MW., Sicinski P., Cantley L., Wei W. DIP original experiment: DIP-260756X Nature 2014 IMEx Cell-cycle-regulated activation of Akt kinase by phosphorylation at its carboxyl terminus. akt1_human RAC-alpha serine/threonine-protein kinase AKT1 PKB RAC RAC-PK-alpha Protein kinase B Proto-oncogene c-Akt Protein kinase B alpha protein protein human Homo sapiens Human MSDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVDQREAPLNNFSVAQCQLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKKQEEEEMDFRSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKILKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLSRERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGIKDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKKLSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMECVDSERRPHFPQFSYSASGTA DIP protein P31749 original sequence version: 184 DIP protein P31749 original sequence version: 168 DIP protein P31749 original sequence version: 102 DIP protein P31749 original sequence version: 110 DIP protein P31749 original sequence version: 160 DIP protein P31749 original sequence version: 136 DIP protein P31749 original sequence version: 175 DIP protein P31749 original sequence version: 201 DIP protein P31749 original sequence version: 166 DIP protein P31749 original sequence version: 178 DIP protein P31749-1 original sequence version: 194 DIP protein P31749 original sequence version: 106 DIP protein P31749 original sequence version: 141 6EAFF4F8AD436714 phlp2_human PH domain leucine-rich repeat-containing protein phosphatase 2 PHLPP2 KIAA0931 PHLPPL PH domain leucine-rich repeat-containing protein phosphatase-like protein protein human Homo sapiens Human MKRNGSRNCLNRRSRFGSRERDWLREDVKRGCVYLYGADTTTATTTTTTSSSSSSSSSSSDLHLVLCTVETPASEICAGEGRESLYLQLHGDLVRRLEPTERPLQIVYDYLSRLGFDDPVRIQEEATNPDLGCMIRFYGEKPCHMDRLDRILLSGIYNVRKGKTQLHKWAERLVVLCGTCLIVSSVKDCQTGKMHILPLVGGKIEEVKRRQYSLAFSSAGAQAQTYHVSFETLAEYQRWQRQASKVVSQRISTVDLSCYSLEEVPEHLFYSQDITYLNLRHNFMQLERPGGLDTLYKFSQLKGLNLSHNKLGLFPILLCEISTLTELNLSCNGFHDLPSQIGNLLNLQTLCLDGNFLTTLPEELGNLQQLSSLGISFNNFSQIPEVYEKLTMLDRVVMAGNCLEVLNLGVLNRMNHIKHVDLRMNHLKTMVIENLEGNKHITHVDLRDNRLTDLDLSSLCSLEQLHCGRNQLRELTLSGFSLRTLYASSNRLTAVNVYPVPSLLTFLDLSRNLLECVPDWACEAKKIEVLDVSYNLLTEVPVRILSSLSLRKLMLGHNHVQNLPTLVEHIPLEVLDLQHNALTRLPDTLFSKALNLRYLNASANSLESLPSACTGEESLSMLQLLYLTNNLLTDQCIPVLVGHLHLRILHLANNQLQTFPASKLNKLEQLEELNLSGNKLKTIPTTIANCKRLHTLVAHSNNISIFPEILQLPQIQFVDLSCNDLTEILIPEALPATLQDLDLTGNTNLVLEHKTLDIFSHITTLKIDQKPLPTTDSTVTSTFWSHGLAEMAGQRNKLCVSALAMDSFAEGVGAVYGMFDGDRNEELPRLLQCTMADVLLEEVQQSTNDTVFMANTFLVSHRKLGMAGQKLGSSALLCYIRPDTADPASSFSLTVANVGTCQAVLCRGGKPVPLSKVFSLEQDPEEAQRVKDQKAIITEDNKVNGVTCCTRMLGCTYLYPWILPKPHISSTPLTIQDELLILGNKALWEHLSYTEAVNAVRHVQDPLAAAKKLCTLAQSYGCQDNVGAMVVYLNIGEEGCTCEMNGLTLPGPVGFASTTTIKDAPKPATPSSSSGIASEFSSEMSTSEVSSEVGSTASDEHNAGGLDTALLPRPERRCSLHPTPTSGLFQRQPSSATFSSNQSDNGLDSDDDQPVEGVITNGSKVEVEVDIHCCRGRDLENSPPLIESSPTLCSEEHARGSCFGIRRQNSVNSGMLLPMSKDRMELQKSPSTSCLYGKKLSNGSIVPLEDSLNLIEVATEVPKRKTGYFAAPTQMEPEDQFVVPHDLEEEVKEQMKQHQDSRLEPEPHEEDRTEPPEEFDTAL DIP protein Q6ZVD8 original sequence version: 104 04FC8550C2E22A6D mtor_human Serine/threonine-protein kinase mTOR MTOR FRAP FRAP2 FK506-binding protein 12-rapamycin complex-associated protein 1 Rapamycin target protein 1 FRAP1 Mammalian target of rapamycin FKBP12-rapamycin complex-associated protein Mechanistic target of rapamycin RAFT1 RAPT1 Rapamycin and FKBP12 target 1 protein protein human Homo sapiens Human MLGTGPAAATTAATTSSNVSVLQQFASGLKSRNEETRAKAAKELQHYVTMELREMSQEESTRFYDQLNHHIFELVSSSDANERKGGILAIASLIGVEGGNATRIGRFANYLRNLLPSNDPVVMEMASKAIGRLAMAGDTFTAEYVEFEVKRALEWLGADRNEGRRHAAVLVLRELAISVPTFFFQQVQPFFDNIFVAVWDPKQAIREGAVAALRACLILTTQREPKEMQKPQWYRHTFEEAEKGFDETLAKEKGMNRDDRIHGALLILNELVRISSMEGERLREEMEEITQQQLVHDKYCKDLMGFGTKPRHITPFTSFQAVQPQQSNALVGLLGYSSHQGLMGFGTSPSPAKSTLVESRCCRDLMEEKFDQVCQWVLKCRNSKNSLIQMTILNLLPRLAAFRPSAFTDTQYLQDTMNHVLSCVKKEKERTAAFQALGLLSVAVRSEFKVYLPRVLDIIRAALPPKDFAHKRQKAMQVDATVFTCISMLARAMGPGIQQDIKELLEPMLAVGLSPALTAVLYDLSRQIPQLKKDIQDGLLKMLSLVLMHKPLRHPGMPKGLAHQLASPGLTTLPEASDVGSITLALRTLGSFEFEGHSLTQFVRHCADHFLNSEHKEIRMEAARTCSRLLTPSIHLISGHAHVVSQTAVQVVADVLSKLLVVGITDPDPDIRYCVLASLDERFDAHLAQAENLQALFVALNDQVFEIRELAICTVGRLSSMNPAFVMPFLRKMLIQILTELEHSGIGRIKEQSARMLGHLVSNAPRLIRPYMEPILKALILKLKDPDPDPNPGVINNVLATIGELAQVSGLEMRKWVDELFIIIMDMLQDSSLLAKRQVALWTLGQLVASTGYVVEPYRKYPTLLEVLLNFLKTEQNQGTRREAIRVLGLLGALDPYKHKVNIGMIDQSRDASAVSLSESKSSQDSSDYSTSEMLVNMGNLPLDEFYPAVSMVALMRIFRDQSLSHHHTMVVQAITFIFKSLGLKCVQFLPQVMPTFLNVIRVCDGAIREFLFQQLGMLVSFVKSHIRPYMDEIVTLMREFWVMNTSIQSTIILLIEQIVVALGGEFKLYLPQLIPHMLRVFMHDNSPGRIVSIKLLAAIQLFGANLDDYLHLLLPPIVKLFDAPEAPLPSRKAALETVDRLTESLDFTDYASRIIHPIVRTLDQSPELRSTAMDTLSSLVFQLGKKYQIFIPMVNKVLVRHRINHQRYDVLICRIVKGYTLADEEEDPLIYQHRMLRSGQGDALASGPVETGPMKKLHVSTINLQKAWGAARRVSKDDWLEWLRRLSLELLKDSSSPSLRSCWALAQAYNPMARDLFNAAFVSCWSELNEDQQDELIRSIELALTSQDIAEVTQTLLNLAEFMEHSDKGPLPLRDDNGIVLLGERAAKCRAYAKALHYKELEFQKGPTPAILESLISINNKLQQPEAAAGVLEYAMKHFGELEIQATWYEKLHEWEDALVAYDKKMDTNKDDPELMLGRMRCLEALGEWGQLHQQCCEKWTLVNDETQAKMARMAAAAAWGLGQWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLAQQCIDKARDLLDAELTAMAGESYSRAYGAMVSCHMLSELEEVIQYKLVPERREIIRQIWWERLQGCQRIVEDWQKILMVRSLVVSPHEDMRTWLKYASLCGKSGRLALAHKTLVLLLGVDPSRQLDHPLPTVHPQVTYAYMKNMWKSARKIDAFQHMQHFVQTMQQQAQHAIATEDQQHKQELHKLMARCFLKLGEWQLNLQGINESTIPKVLQYYSAATEHDRSWYKAWHAWAVMNFEAVLHYKHQNQARDEKKKLRHASGANITNATTAATTAATATTTASTEGSNSESEAESTENSPTPSPLQKKVTEDLSKTLLMYTVPAVQGFFRSISLSRGNNLQDTLRVLTLWFDYGHWPDVNEALVEGVKAIQIDTWLQVIPQLIARIDTPRPLVGRLIHQLLTDIGRYHPQALIYPLTVASKSTTTARHNAANKILKNMCEHSNTLVQQAMMVSEELIRVAILWHEMWHEGLEEASRLYFGERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQAWDLYYHVFRRISKQLPQLTSLELQYVSPKLLMCRDLELAVPGTYDPNQPIIRIQSIAPSLQVITSKQRPRKLTLMGSNGHEFVFLLKGHEDLRQDERVMQLFGLVNTLLANDPTSLRKNLSIQRYAVIPLSTNSGLIGWVPHCDTLHALIRDYREKKKILLNIEHRIMLRMAPDYDHLTLMQKVEVFEHAVNNTAGDDLAKLLWLKSPSSEVWFDRRTNYTRSLAVMSMVGYILGLGDRHPSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFRLTRMLTNAMEVTGLDGNYRITCHTVMEVLREHKDSVMAVLEAFVYDPLLNWRLMDTNTKGNKRSRTRTDSYSAGQSVEILDGVELGEPAHKKTGTTVPESIHSFIGDGLVKPEALNKKAIQIINRVRDKLTGRDFSHDDTLDVPTQVELLIKQATSHENLCQCYIGWCPFW DIP protein P42345 original sequence version: 158 DIP protein P42345 original sequence version: 82 DIP protein P42345 original sequence version: 108 DIP protein P42345 original sequence version: 107 DIP protein P42345 original sequence version: 138 DIP protein P42345 original sequence version: 168 DIP protein P42345 original sequence version: 173 DIP protein P42345 original sequence version: 120 DIP protein P42345 original sequence version: 149 DIP protein P42345 original sequence version: 134 DIP protein P42345 original sequence version: 148 DIP protein P42345 original sequence version: 118 7D9AD6E784882AB4 them4_human Acyl-coenzyme A thioesterase THEM4 THEM4 CTMP Carboxyl-terminal modulator protein Thioesterase superfamily member 4 protein protein human Homo sapiens Human MLRSCAARLRTLGALCLPPVGRRLPGSEPRPELRSFSSEEVILKDCSVPNPSWNKDLRLLFDQFMKKCEDGSWKRLPSYKRTPTEWIQDFKTHFLDPKLMKEEQMSQAQLFTRSFDDGLGFEYVMFYNDIEKRMVCLFQGGPYLEGPPGFIHGGAIATMIDATVGMCAMMAGGIVMTANLNINYKRPIPLCSVVMINSQLDKVEGRKFFVSCNVQSVDEKTLYSEATSLFIKLNPAKSLT DIP protein Q5T1C6 original sequence version: 84 DIP protein Q5T1C6 original sequence version: 87 mint homomint A01071B07A1B5FB2 akt2_human RAC-beta serine/threonine-protein kinase AKT2 RAC-PK-beta Protein kinase Akt-2 Protein kinase B beta protein protein human Homo sapiens Human MNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPEAPDQTLPPLNNFSVAECQLMKTERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWMRAIQMVANSLKQRAPGEDPMDYKCGSPSDSSTTEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAMKILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFHLSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEGISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFELILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQKKLLPPFKPQVTSEVDTRYFDDEFTAQSITITPPDRYDSLGLLELDQRTHFPQFSYSASIRE DIP protein P31751 original sequence version: 137 DIP protein P31751 original sequence version: 155 B18C87A7246BFB24 sin1_human Target of rapamycin complex 2 subunit MAPKAP1 MIP1 Mitogen-activated protein kinase 2-associated protein 1 Stress-activated map kinase-interacting protein 1 MAPKAP1 SIN1 protein protein human Homo sapiens Human MAFLDNPTIILAHIRQSHVTSDDTGMCEMVLIDHDVDLEKIHPPSMPGDSGSEIQGSNGETQGYVYAQSVDITSSWDFGIRRRSNTAQRLERLRKERQNQIKCKNIQWKERNSKQSAQELKSLFEKKSLKEKPPISGKQSILSVRLEQCPLQLNNPFNEYSKFDGKGHVGTTATKKIDVYLPLHSSQDRLLPMTVVTMASARVQDLIGLICWQYTSEGREPKLNDNVSAYCLHIAEDDGEVDTDFPPLDSNEPIHKFGFSTLALVEKYSSPGLTSKESLFVRINAAHGFSLIQVDNTKVTMKEILLKAVKRRKGSQKVSGPQYRLEKQSEPNVAVDLDSTLESQSAWEFCLVRENSSRADGVFEEDSQIDIATVQDMLSSHHYKSFKVSMIHRLRFTTDVQLGISGDKVEIDPVTNQKASTKFWIKQKPISIDSDLLCACDLAEEKSPSHAIFKLTYLSNHDYKHLYFESDAATVNEIVLKVNYILESRASTARADYFAQKQRKLNRRTSFSFQKEKKSGQQ DIP protein Q9BPZ7 original sequence version: 111 E3B808C6E58F7C48 ccna2_human Cyclin-A2 Cyclin A CCNA2 CCN1 CCNA protein protein human Homo sapiens Human MLGNSAPGPATREAGSALLALQQTALQEDQENINPEKAAPVQQPRTRAALAVLKSGNPRGLAQQQRPKTRRVAPLKDLPVNDEHVTVPPWKANSKQPAFTIHVDEAEKEAQKKPAESQKIEREDALAFNSAISLPGPRKPLVPLDYPMDGSFESPHTMDMSIILEDEKPVSVNEVPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL DIP protein P20248 original sequence version: 183 DIP protein P20248 original sequence version: 146 DIP protein P20248 original sequence version: 168 DIP protein P20248 original sequence version: 149 DIP protein P20248 original sequence version: 111 97763A2897DD35F4 akt3_human RAC-gamma serine/threonine-protein kinase AKT3 PKBG RAC-PK-gamma Protein kinase Akt-3 Protein kinase B gamma STK-2 protein protein human Homo sapiens Human MSDVTIVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDVDLPYPLNNFSVAKCQLMKTERPKPNTFIIRCLQWTTVIERTFHVDTPEEREEWTEAIQAVADRLQRQEEERMNCSPTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILKKEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRERVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDAATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGVNWQDVYDKKLVPPFKPQVTSETDTRYFDEEFTAQTITITPPEKYDEDGMDCMDNERRPHFPQFSYSASGRE DIP protein Q9Y243 original sequence version: 150 F08BDDE6502E78FB akt1-ccna2-1 9 16 unspecified role unspecified role prey prey human Homo sapiens Human 10 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association akt3-ccna2-1 5 17 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 16 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association mapkap1-akt1-1 1 15 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 10 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P31749:p.[Ser477Asp;Thr479Glu] S477D/T479E mutation increasing strength mutation increasing interaction strength mutation increasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain T E certain certain sequence position certain certain certain sequence position certain S D This feature has been corrected as a result of our quality control procedures. The original label was 'S477D/T479E'. Wed May 02 16:05:11 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser477asp,thr479glu' Tue Jun 30 18:34:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser477Asp;Thr479Glu]' human Homo sapiens Human physical association physical association akt1-phlpp2-1 2 13 unspecified role unspecified role prey prey human Homo sapiens Human 11 unspecified role unspecified role prey prey human Homo sapiens Human 10 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human association association akt1-ccna2-2 7 16 unspecified role unspecified role prey prey human Homo sapiens Human 10 unspecified role unspecified role bait bait P31749:p.[Arg76Ala;Leu78Ala] R76A/L78A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R76A/L78A'. Wed May 02 15:36:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg76ala,leu78ala' Tue Jun 30 20:24:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg76Ala;Leu78Ala]' P31749:p.[Arg273Ala;Leu275Ala] R273A/L275A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R273A/L275A'. Wed May 02 20:15:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg273ala,leu275ala' Tue Jun 30 19:57:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg273Ala;Leu275Ala]' P31749:p.[Arg370Ala;Leu372Ala] R370A/L372A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R370A/L372A'. Wed May 02 20:04:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg370ala,leu372ala' Tue Jun 30 15:50:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg370Ala;Leu372Ala]' HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P31749:p.Arg76Ala R76A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R76A'. Wed May 02 18:44:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg76ala' Tue Jun 30 15:49:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg76Ala' P31749:p.[Arg76Ala;Ser477Asp;Thr479Glu] R76A/S477D/T479E mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain T E certain certain sequence position certain certain certain sequence position certain S D This feature has been corrected as a result of our quality control procedures. The original label was 'R76A/S477D/T479E'. Wed May 02 19:05:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg76ala,ser477asp,thr479glu' Tue Jun 30 18:29:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg76Ala;Ser477Asp;Thr479Glu]' human Homo sapiens Human physical association physical association mtor-1 6 12 putative self putative self unspecified role unspecified role ecolx Escherichia coli phosphorylation phosphorylation reaction phosphorylation true akt1-mtor-2 3 10 enzyme target enzyme target substrate substrate unspecified role unspecified role Region 409-480 Region 409-480 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain pT479 pT479 opthr O-phospho-L-threonine (2S,3R)-2-amino-3-(phosphonooxy)butanoic acid 2-amino-3-hydroxybutanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)butanoic acid MOD_RES Phosphothreonine O-phospho-L-threonine O-phosphorylated L-threonine O3-phosphothreonine threonine phosphate ester OPThr Phospho Phospho Threonyl Phosphorylation phosphorylationt modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain resulting-ptm resulting-ptm resulting ptm resulting-ptm P31749:p.[Ser473Ala;Ser477Ala;Thr479Ala] S473A/S477A/T479A mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain T A certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain S A This feature has been corrected as a result of our quality control procedures. The original label was 'S473A/S477A/T479A'. Wed May 02 16:21:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser473ala,ser477ala,thr479ala' Tue Jun 30 17:17:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser473Ala;Ser477Ala;Thr479Ala]' pS473 pS473 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations western blot western blot Immuno blot Immuno blot certain certain sequence position certain certain certain sequence position certain resulting-ptm resulting-ptm resulting ptm resulting-ptm ecolx Escherichia coli 12 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli phosphorylation phosphorylation reaction phosphorylation mtor-akt1-1 8 10 unspecified role unspecified role prey prey P31749:p.[Ser477Asp;Thr479Glu] S477D/T479E mutation increasing strength mutation increasing interaction strength mutation increasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain T E certain certain sequence position certain certain certain sequence position certain S D This feature has been corrected as a result of our quality control procedures. The original label was 'S477D/T479E'. Wed May 02 15:36:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser477asp,thr479glu' Tue Jun 30 18:51:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser477Asp;Thr479Glu]' HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 12 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association akt2-ccna2-1 4 14 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 16 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association