DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Coordinated rearrangements between cytoplasmic and periplasmic domains of the membrane protein complex ExbB-ExbD of Escherichia coli. Coordinated rearrangements between cytoplasmic and periplasmic domains of the membrane protein complex ExbB-ExbD of Escherichia coli. Structure (London, England : 1993) 2014 imex curation Sverzhinsky A., Fabre L., Cottreau AL., Biot-Pelletier DM., Khalil S., Bostina M., Rouiller I., Coulton JW. Only protein-protein interactions ecolx Escherichia coli pull down pull down weight silver stain molecular weight estimation by silver staining weight silver stain Sverzhinsky A., Fabre L., Cottreau AL., Biot-Pelletier DM., Khalil S., Bostina M., Rouiller I., Coulton JW. DIP original experiment: DIP-260629X Structure (London, England : 1993) 2014 IMEx Coordinated rearrangements between cytoplasmic and periplasmic domains of the membrane protein complex ExbB-ExbD of Escherichia coli. Coordinated rearrangements between cytoplasmic and periplasmic domains of the membrane protein complex ExbB-ExbD of Escherichia coli. Coordinated rearrangements between cytoplasmic and periplasmic domains of the membrane protein complex ExbB-ExbD of Escherichia coli. Structure (London, England : 1993) 2014 imex curation Sverzhinsky A., Fabre L., Cottreau AL., Biot-Pelletier DM., Khalil S., Bostina M., Rouiller I., Coulton JW. Only protein-protein interactions ecolx Escherichia coli bn-page blue native page bn-page predetermined predetermined participant predetermined Sverzhinsky A., Fabre L., Cottreau AL., Biot-Pelletier DM., Khalil S., Bostina M., Rouiller I., Coulton JW. DIP original experiment: DIP-260633X Structure (London, England : 1993) 2014 IMEx Coordinated rearrangements between cytoplasmic and periplasmic domains of the membrane protein complex ExbB-ExbD of Escherichia coli. Coordinated rearrangements between cytoplasmic and periplasmic domains of the membrane protein complex ExbB-ExbD of Escherichia coli. Coordinated rearrangements between cytoplasmic and periplasmic domains of the membrane protein complex ExbB-ExbD of Escherichia coli. Structure (London, England : 1993) 2014 imex curation Sverzhinsky A., Fabre L., Cottreau AL., Biot-Pelletier DM., Khalil S., Bostina M., Rouiller I., Coulton JW. Only protein-protein interactions ecolx Escherichia coli tem transmission electron microscopy tem predetermined predetermined participant predetermined Sverzhinsky A., Fabre L., Cottreau AL., Biot-Pelletier DM., Khalil S., Bostina M., Rouiller I., Coulton JW. DIP original experiment: DIP-260632X Structure (London, England : 1993) 2014 IMEx Coordinated rearrangements between cytoplasmic and periplasmic domains of the membrane protein complex ExbB-ExbD of Escherichia coli. Coordinated rearrangements between cytoplasmic and periplasmic domains of the membrane protein complex ExbB-ExbD of Escherichia coli. Coordinated rearrangements between cytoplasmic and periplasmic domains of the membrane protein complex ExbB-ExbD of Escherichia coli. Structure (London, England : 1993) 2014 imex curation Sverzhinsky A., Fabre L., Cottreau AL., Biot-Pelletier DM., Khalil S., Bostina M., Rouiller I., Coulton JW. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Sverzhinsky A., Fabre L., Cottreau AL., Biot-Pelletier DM., Khalil S., Bostina M., Rouiller I., Coulton JW. DIP original experiment: DIP-260630X Structure (London, England : 1993) 2014 IMEx Coordinated rearrangements between cytoplasmic and periplasmic domains of the membrane protein complex ExbB-ExbD of Escherichia coli. Coordinated rearrangements between cytoplasmic and periplasmic domains of the membrane protein complex ExbB-ExbD of Escherichia coli. Coordinated rearrangements between cytoplasmic and periplasmic domains of the membrane protein complex ExbB-ExbD of Escherichia coli. Structure (London, England : 1993) 2014 imex curation Sverzhinsky A., Fabre L., Cottreau AL., Biot-Pelletier DM., Khalil S., Bostina M., Rouiller I., Coulton JW. Only protein-protein interactions ecolx Escherichia coli light scattering light scattering predetermined predetermined participant predetermined Sverzhinsky A., Fabre L., Cottreau AL., Biot-Pelletier DM., Khalil S., Bostina M., Rouiller I., Coulton JW. DIP original experiment: DIP-260631X Structure (London, England : 1993) 2014 IMEx Coordinated rearrangements between cytoplasmic and periplasmic domains of the membrane protein complex ExbB-ExbD of Escherichia coli. exbb_ecoli Biopolymer transport protein ExbB JW2974 b3006 exbB protein protein ecoli Escherichia coli (strain K12) MGNNLMQTDLSVWGMYQHADIVVKCVMIGLILASVVTWAIFFSKSVEFFNQKRRLKREQQLLAEARSLNQANDIAADFGSKSLSLHLLNEAQNELELSEGSDDNEGIKERTSFRLERRVAAVGRQMGRGNGYLATIGAISPFVGLFGTVWGIMNSFIGIAQTQTTNLAVVAPGIAEALLATAIGLVAAIPAVVIYNVFARQIGGFKAMLGDVAAQVLLLQSRDLDLEASAAAHPVRVAQKLRAG DIP protein P0ABU7 original sequence version: 37 DIP protein P0ABU7 original sequence version: 72 CEB63893A80BA71F exbd_ecoli Biopolymer transport protein ExbD exbD JW2973 b3005 protein protein ecoli Escherichia coli (strain K12) MAMHLNENLDDNGEMHDINVTPFIDVMLVLLIIFMVAAPLATVDVKVNLPASTSTPQPRPEKPVYLSVKADNSMFIGNDPVTDETMITALNALTEGKKDTTIFFRADKTVDYETLMKVMDTLHQAGYLKIGLVGEETAKAK DIP protein P0ABV2 original sequence version: 70 25A539A2FAEB9F6C exbd-exbb-1 1 6 unspecified role unspecified role prey prey ecolx Escherichia coli 7 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli physical association physical association exbb-exbd-1 3 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction exbb-exbd-2 4 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction exbb-exbd-4 2 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction exbb-exbd-5 5 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction