DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structural basis of the proinflammatory signaling complex mediated by TSLP. Structural basis of the proinflammatory signaling complex mediated by TSLP. Nature structural & molecular biology 2014 imex curation Verstraete K., van Schie L., Vyncke L., Bloch Y., Tavernier J., Pauwels E., Peelman F., Savvides SN. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Verstraete K., van Schie L., Vyncke L., Bloch Y., Tavernier J., Pauwels E., Peelman F., Savvides SN. DIP original experiment: DIP-260863X Nature structural & molecular biology 2014 IMEx Structural basis of the proinflammatory signaling complex mediated by TSLP. Structural basis of the proinflammatory signaling complex mediated by TSLP. Structural basis of the proinflammatory signaling complex mediated by TSLP. Nature structural & molecular biology 2014 imex curation Verstraete K., van Schie L., Vyncke L., Bloch Y., Tavernier J., Pauwels E., Peelman F., Savvides SN. Only protein-protein interactions in vitro In vitro light scattering light scattering predetermined predetermined participant predetermined Verstraete K., van Schie L., Vyncke L., Bloch Y., Tavernier J., Pauwels E., Peelman F., Savvides SN. DIP original experiment: DIP-260870X Nature structural & molecular biology 2014 IMEx Structural basis of the proinflammatory signaling complex mediated by TSLP. Structural basis of the proinflammatory signaling complex mediated by TSLP. Structural basis of the proinflammatory signaling complex mediated by TSLP. Nature structural & molecular biology 2014 imex curation Verstraete K., van Schie L., Vyncke L., Bloch Y., Tavernier J., Pauwels E., Peelman F., Savvides SN. Only protein-protein interactions in vitro In vitro light scattering light scattering predetermined predetermined participant predetermined Verstraete K., van Schie L., Vyncke L., Bloch Y., Tavernier J., Pauwels E., Peelman F., Savvides SN. DIP original experiment: DIP-260868X Nature structural & molecular biology 2014 IMEx Structural basis of the proinflammatory signaling complex mediated by TSLP. Structural basis of the proinflammatory signaling complex mediated by TSLP. Structural basis of the proinflammatory signaling complex mediated by TSLP. Nature structural & molecular biology 2014 imex curation Verstraete K., van Schie L., Vyncke L., Bloch Y., Tavernier J., Pauwels E., Peelman F., Savvides SN. Only protein-protein interactions human Homo sapiens Human molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Verstraete K., van Schie L., Vyncke L., Bloch Y., Tavernier J., Pauwels E., Peelman F., Savvides SN. DIP original experiment: DIP-260864X Nature structural & molecular biology 2014 IMEx Structural basis of the proinflammatory signaling complex mediated by TSLP. Structural basis of the proinflammatory signaling complex mediated by TSLP. Structural basis of the proinflammatory signaling complex mediated by TSLP. Nature structural & molecular biology 2014 imex curation Verstraete K., van Schie L., Vyncke L., Bloch Y., Tavernier J., Pauwels E., Peelman F., Savvides SN. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Verstraete K., van Schie L., Vyncke L., Bloch Y., Tavernier J., Pauwels E., Peelman F., Savvides SN. DIP original experiment: DIP-260866X Nature structural & molecular biology 2014 IMEx Structural basis of the proinflammatory signaling complex mediated by TSLP. Structural basis of the proinflammatory signaling complex mediated by TSLP. Structural basis of the proinflammatory signaling complex mediated by TSLP. Nature structural & molecular biology 2014 imex curation Verstraete K., van Schie L., Vyncke L., Bloch Y., Tavernier J., Pauwels E., Peelman F., Savvides SN. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Verstraete K., van Schie L., Vyncke L., Bloch Y., Tavernier J., Pauwels E., Peelman F., Savvides SN. DIP original experiment: DIP-260869X Nature structural & molecular biology 2014 IMEx Structural basis of the proinflammatory signaling complex mediated by TSLP. Structural basis of the proinflammatory signaling complex mediated by TSLP. Structural basis of the proinflammatory signaling complex mediated by TSLP. Nature structural & molecular biology 2014 imex curation Verstraete K., van Schie L., Vyncke L., Bloch Y., Tavernier J., Pauwels E., Peelman F., Savvides SN. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Verstraete K., van Schie L., Vyncke L., Bloch Y., Tavernier J., Pauwels E., Peelman F., Savvides SN. DIP original experiment: DIP-260862X Nature structural & molecular biology 2014 IMEx Structural basis of the proinflammatory signaling complex mediated by TSLP. Structural basis of the proinflammatory signaling complex mediated by TSLP. Structural basis of the proinflammatory signaling complex mediated by TSLP. Nature structural & molecular biology 2014 imex curation Verstraete K., van Schie L., Vyncke L., Bloch Y., Tavernier J., Pauwels E., Peelman F., Savvides SN. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Verstraete K., van Schie L., Vyncke L., Bloch Y., Tavernier J., Pauwels E., Peelman F., Savvides SN. DIP original experiment: DIP-260865X Nature structural & molecular biology 2014 IMEx Structural basis of the proinflammatory signaling complex mediated by TSLP. Structural basis of the proinflammatory signaling complex mediated by TSLP. Structural basis of the proinflammatory signaling complex mediated by TSLP. Nature structural & molecular biology 2014 imex curation Verstraete K., van Schie L., Vyncke L., Bloch Y., Tavernier J., Pauwels E., Peelman F., Savvides SN. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Verstraete K., van Schie L., Vyncke L., Bloch Y., Tavernier J., Pauwels E., Peelman F., Savvides SN. DIP original experiment: DIP-260867X Nature structural & molecular biology 2014 IMEx Structural basis of the proinflammatory signaling complex mediated by TSLP. Structural basis of the proinflammatory signaling complex mediated by TSLP. Structural basis of the proinflammatory signaling complex mediated by TSLP. Nature structural & molecular biology 2014 imex curation Verstraete K., van Schie L., Vyncke L., Bloch Y., Tavernier J., Pauwels E., Peelman F., Savvides SN. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Verstraete K., van Schie L., Vyncke L., Bloch Y., Tavernier J., Pauwels E., Peelman F., Savvides SN. DIP original experiment: DIP-260871X Nature structural & molecular biology 2014 IMEx Structural basis of the proinflammatory signaling complex mediated by TSLP. il7ra_mouse Interleukin-7 receptor subunit alpha Il7r protein protein mouse Mus musculus Mouse MMALGRAFAIVFCLIQAVSGESGNAQDGDLEDADADDHSFWCHSQLEVDGSQHLLTCAFNDSDINTANLEFQICGALLRVKCLTLNKLQDIYFIKTSEFLLIGSSNICVKLGQKNLTCKNMAINTIVKAEAPSDLKVVYRKEANDFLVTFNAPHLKKKYLKKVKHDVAYRPARGESNWTHVSLFHTRTTIPQRKLRPKAMYEIKVRSIPHNDYFKGFWSEWSPSSTFETPEPKNQGGWDPVLPSVTILSLFSVFLLVILAHVLWKKRIKPVVWPSLPDHKKTLEQLCKKPKTSLNVSFNPESFLDCQIHEVKGVEARDEVESFLPNDLPAQPEELETQGHRAAVHSANRSPETSVSPPETVRRESPLRCLARNLSTCNAPPLLSSRSPDYRDGDRNRPPVYQDLLPNSGNTNVPVPVPQPLPFQSGILIPVSQRQPISTSSVLNQEEAYVTMSSFYQNK DIP protein P16872 original sequence version: 106 DIP protein P16872 original sequence version: 130 crlf2_mouse Cytokine receptor-like factor 2 Crlf2 Crlm2 Tpte2 Tslpr Cytokine receptor-like molecule 2 Thymic stromal lymphopoietin protein receptor Type I cytokine receptor delta 1 protein protein mouse Mus musculus Mouse MAWALAVILLPRLLAAAAAAAAVTSRGDVTVVCHDLETVEVTWGSGPDHHGANLSLEFRYGTGALQPCPRYFLSGAGVTSGCILPAARAGLLELALRDGGGAMVFKARQRASAWLKPRPPWNVTLLWTPDGDVTVSWPAHSYLGLDYEVQHRESNDDEDAWQTTSGPCCDLTVGGLDPARCYDFRVRASPRAAHYGLEAQPSEWTAVTRLSGAASAASCTASPAPSPALAPPLLPLGCGLAALLTLSLLLAALRLRRVKDALLPCVPDPSGSFPGLFEKHHGNFQAWIADAQATAPPARTEEEDDLIHPKAKRVEPEDGTSLCTVPRPPSFEPRGPGGGAMVSVGGATFMVGDSGYMTL DIP protein Q8CII9 original sequence version: 85 DIP protein Q8CII9-1 original sequence version: 106 tslp_mouse Thymic stromal lymphopoietin Tslp Thymic stroma-derived lymphopoietin protein protein mouse Mus musculus Mouse MVLLRSLFILQVLVRMGLTYNFSNCNFTSITKIYCNIIFHDLTGDLKGAKFEQIEDCESKPACLLKIEYYTLNPIPGCPSLPDKTFARRTREALNDHCPGYPETERNDGTQEMAQEVQNICLNQTSQILRLWYSFMQSPE DIP protein Q9JIE6 original sequence version: 62 tslp-crlf2-1 10 12 unspecified role unspecified role prey prey Region 20-222 Region 20-222 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 13 unspecified role unspecified role bait bait Region 20-140 Region 20-140 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human direct interaction direct interaction crlf2-il7r-1 7 12 unspecified role unspecified role unspecified role unspecified role Region 20-222 Region 20-222 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 11 unspecified role unspecified role unspecified role unspecified role Region 21-239 Region 21-239 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 13 unspecified role unspecified role unspecified role unspecified role Region 20-140 Region 20-140 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human physical association physical association crlf2-tslp-1 3 12 unspecified role unspecified role unspecified role unspecified role Region 20-222 Region 20-222 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 13 unspecified role unspecified role unspecified role unspecified role Region 20-140 Region 20-140 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human direct interaction direct interaction tslp-il7r-1 5 11 unspecified role unspecified role prey prey Region 21-239 Region 21-239 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 13 unspecified role unspecified role bait bait Region 20-140 Region 20-140 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human direct interaction direct interaction crlf2-tslp-2 4 12 unspecified role unspecified role unspecified role unspecified role Region 20-222 Region 20-222 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 13 unspecified role unspecified role unspecified role unspecified role Region 20-140 Region 20-140 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human direct interaction direct interaction crlf2-il7r-2 1 12 unspecified role unspecified role unspecified role unspecified role Region 20-222 Region 20-222 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 11 unspecified role unspecified role unspecified role unspecified role Region 21-239 Region 21-239 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 13 unspecified role unspecified role unspecified role unspecified role Region 20-140 Region 20-140 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human direct interaction direct interaction crlf2-il7r-3 6 12 unspecified role unspecified role unspecified role unspecified role Region 20-222 Region 20-222 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 11 unspecified role unspecified role unspecified role unspecified role Region 21-239 Region 21-239 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 13 unspecified role unspecified role unspecified role unspecified role Region 20-140 Region 20-140 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human physical association physical association crlf2-tslp-3 9 12 unspecified role unspecified role unspecified role unspecified role Region 20-222 Region 20-222 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 13 unspecified role unspecified role unspecified role unspecified role Region 20-140 Region 20-140 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human direct interaction direct interaction crlf2-tslp-4 8 12 unspecified role unspecified role unspecified role unspecified role Region 20-222 Region 20-222 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 13 unspecified role unspecified role unspecified role unspecified role Region 20-140 Region 20-140 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human direct interaction direct interaction crlf2-il7r-4 2 12 unspecified role unspecified role unspecified role unspecified role Region 20-222 Region 20-222 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 11 unspecified role unspecified role unspecified role unspecified role Region 21-239 Region 21-239 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 13 unspecified role unspecified role unspecified role unspecified role Region 20-140 Region 20-140 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human physical association physical association