DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Design of a bZip transcription factor with homo/heterodimer-induced DNA-binding preference. Design of a bZip transcription factor with homo/heterodimer-induced DNA-binding preference. Structure (London, England : 1993) 2014 imex curation Pogenberg V., Consani Textor L., Vanhille L., Holton SJ., Sieweke MH., Wilmanns M. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Pogenberg V., Consani Textor L., Vanhille L., Holton SJ., Sieweke MH., Wilmanns M. DIP original experiment: DIP-259697X Structure (London, England : 1993) 2014 IMEx Design of a bZip transcription factor with homo/heterodimer-induced DNA-binding preference. Design of a bZip transcription factor with homo/heterodimer-induced DNA-binding preference. Design of a bZip transcription factor with homo/heterodimer-induced DNA-binding preference. Structure (London, England : 1993) 2014 imex curation Pogenberg V., Consani Textor L., Vanhille L., Holton SJ., Sieweke MH., Wilmanns M. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Pogenberg V., Consani Textor L., Vanhille L., Holton SJ., Sieweke MH., Wilmanns M. DIP original experiment: DIP-259696X Structure (London, England : 1993) 2014 IMEx Design of a bZip transcription factor with homo/heterodimer-induced DNA-binding preference. Design of a bZip transcription factor with homo/heterodimer-induced DNA-binding preference. Design of a bZip transcription factor with homo/heterodimer-induced DNA-binding preference. Structure (London, England : 1993) 2014 imex curation Pogenberg V., Consani Textor L., Vanhille L., Holton SJ., Sieweke MH., Wilmanns M. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Pogenberg V., Consani Textor L., Vanhille L., Holton SJ., Sieweke MH., Wilmanns M. DIP original experiment: DIP-259695X Structure (London, England : 1993) 2014 IMEx Design of a bZip transcription factor with homo/heterodimer-induced DNA-binding preference. Design of a bZip transcription factor with homo/heterodimer-induced DNA-binding preference. Design of a bZip transcription factor with homo/heterodimer-induced DNA-binding preference. Structure (London, England : 1993) 2014 imex curation Pogenberg V., Consani Textor L., Vanhille L., Holton SJ., Sieweke MH., Wilmanns M. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Pogenberg V., Consani Textor L., Vanhille L., Holton SJ., Sieweke MH., Wilmanns M. DIP original experiment: DIP-259699X Structure (London, England : 1993) 2014 IMEx Design of a bZip transcription factor with homo/heterodimer-induced DNA-binding preference. Design of a bZip transcription factor with homo/heterodimer-induced DNA-binding preference. Design of a bZip transcription factor with homo/heterodimer-induced DNA-binding preference. Structure (London, England : 1993) 2014 imex curation Pogenberg V., Consani Textor L., Vanhille L., Holton SJ., Sieweke MH., Wilmanns M. Only protein-protein interactions mouse Mus musculus Mouse anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Pogenberg V., Consani Textor L., Vanhille L., Holton SJ., Sieweke MH., Wilmanns M. DIP original experiment: DIP-259698X Structure (London, England : 1993) 2014 IMEx Design of a bZip transcription factor with homo/heterodimer-induced DNA-binding preference. mafb_mouse Transcription factor MafB Mafb Krml Maf1 Kreisler Segmentation protein Kr Transcription factor Maf-1 V-maf musculoaponeurotic fibrosarcoma oncogene homolog B protein protein mouse Mus musculus Mouse MAAELSMGQELPTSPLAMEYVNDFDLLKFDVKKEPLGRAERPGRPCTRLQPAGSVSSTPLSTPCSSVPSSPSFSPTEPKTHLEDLYWMASNYQQMNPEALNLTPEDAVEALIGSHPVPQPLQSFDGFRSAHHHHHHHHPHPHHGYPGAGVTHDDLGQHAHPHHHHHHQASPPPSSAASPAQQLPTSHPGPGPHATAAATAAGGNGSVEDRFSDDQLVSMSVRELNRHLRGFTKDEVIRLKQKRRTLKNRGYAQSCRYKRVQQKHHLENEKTQLIQQVEQLKQEVSRLARERDAYKVKCEKLANSGFREAGSTSDSPSSPEFFL DIP protein P54841 original sequence version: 118 fos_mouse Proto-oncogene c-Fos Fos Cellular oncogene fos protein protein mouse Mus musculus Mouse MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNTQDFCADLSVSSANFIPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGLPTQSAGAYARAGMVKTVSGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEASTPESEEAFTLPLLNDPEPKPSLEPVKSISNVELKAEPFDDFLFPASSRPSGSETSRSVPDVDLSGSFYAADWEPLHSNSLGMGPMVTELEPLCTPVVTCTPGCTTYTSSFVFTYPEADSFPSCAAAHRKGSSSNEPSSDSLSSPTLLAL DIP protein P01101 original sequence version: 124 DIP protein P01101 original sequence version: 117 475966265952B624 mafb-1 3 6 unspecified role unspecified role unspecified role unspecified role Region 211-305 Region 211-305 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction fos-mafb-1 2 7 unspecified role unspecified role unspecified role unspecified role Region 138-200 Region 138-200 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 6 unspecified role unspecified role unspecified role unspecified role Region 211-305 Region 211-305 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction mafb-fos-2 5 7 unspecified role unspecified role prey prey mouse Mus musculus Mouse 6 unspecified role unspecified role bait bait P54841:p.Val277Asn V277N mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain V N This feature has been corrected as a result of our quality control procedures. The original label was 'V277N'. Wed May 02 20:05:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val277asn' Tue Jun 30 15:41:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val277Asn' P54841:p.Glu269Arg E269R mutation increasing strength mutation increasing interaction strength mutation increasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain E R This feature has been corrected as a result of our quality control procedures. The original label was 'E269R'. Wed May 02 19:07:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu269arg' Tue Jun 30 17:10:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu269Arg' Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range mouse Mus musculus Mouse physical association physical association fos-mafb-2 1 7 unspecified role unspecified role unspecified role unspecified role Region 138-200 Region 138-200 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 6 unspecified role unspecified role unspecified role unspecified role Region 211-305 Region 211-305 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction fos-mafb-3 4 7 unspecified role unspecified role bait bait mouse Mus musculus Mouse 6 unspecified role unspecified role prey prey P54841:p.Val277Asn V277N mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain V N This feature has been corrected as a result of our quality control procedures. The original label was 'V277N'. Wed May 02 16:08:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val277asn' Tue Jun 30 18:51:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val277Asn' P54841:p.Glu269Arg E269R mutation increasing strength mutation increasing interaction strength mutation increasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain E R This feature has been corrected as a result of our quality control procedures. The original label was 'E269R'. Wed May 02 14:47:35 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu269arg' Tue Jun 30 18:44:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu269Arg' Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range mouse Mus musculus Mouse physical association physical association