DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu In vitro membrane reconstitution of the T-cell receptor proximal signaling network. In vitro membrane reconstitution of the T-cell receptor proximal signaling network. Nature structural & molecular biology 2014 imex curation Hui E., Vale RD. Only protein-protein interactions in vitro In vitro fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Hui E., Vale RD. DIP original experiment: DIP-260052X Nature structural & molecular biology 2014 IMEx In vitro membrane reconstitution of the T-cell receptor proximal signaling network. In vitro membrane reconstitution of the T-cell receptor proximal signaling network. In vitro membrane reconstitution of the T-cell receptor proximal signaling network. Nature structural & molecular biology 2014 imex curation Hui E., Vale RD. Only protein-protein interactions in vitro In vitro protein phosphatase assay protein phosphatase assay predetermined predetermined participant predetermined Hui E., Vale RD. DIP original experiment: DIP-260054X Nature structural & molecular biology 2014 IMEx In vitro membrane reconstitution of the T-cell receptor proximal signaling network. In vitro membrane reconstitution of the T-cell receptor proximal signaling network. In vitro membrane reconstitution of the T-cell receptor proximal signaling network. Nature structural & molecular biology 2014 imex curation Hui E., Vale RD. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Hui E., Vale RD. DIP original experiment: DIP-260050X Nature structural & molecular biology 2014 IMEx In vitro membrane reconstitution of the T-cell receptor proximal signaling network. In vitro membrane reconstitution of the T-cell receptor proximal signaling network. In vitro membrane reconstitution of the T-cell receptor proximal signaling network. Nature structural & molecular biology 2014 imex curation Hui E., Vale RD. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Hui E., Vale RD. DIP original experiment: DIP-260053X Nature structural & molecular biology 2014 IMEx In vitro membrane reconstitution of the T-cell receptor proximal signaling network. In vitro membrane reconstitution of the T-cell receptor proximal signaling network. In vitro membrane reconstitution of the T-cell receptor proximal signaling network. Nature structural & molecular biology 2014 imex curation Hui E., Vale RD. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Hui E., Vale RD. DIP original experiment: DIP-260051X Nature structural & molecular biology 2014 IMEx In vitro membrane reconstitution of the T-cell receptor proximal signaling network. zap70_human Tyrosine-protein kinase ZAP-70 ZAP70 SRK Syk-related tyrosine kinase 70 kDa zeta-chain associated protein protein protein human Homo sapiens Human MPDPAAHLPFFYGSISRAEAEEHLKLAGMADGLFLLRQCLRSLGGYVLSLVHDVRFHHFPIERQLNGTYAIAGGKAHCGPAELCEFYSRDPDGLPCNLRKPCNRPSGLEPQPGVFDCLRDAMVRDYVRQTWKLEGEALEQAIISQAPQVEKLIATTAHERMPWYHSSLTREEAERKLYSGAQTDGKFLLRPRKEQGTYALSLIYGKTVYHYLISQDKAGKYCIPEGTKFDTLWQLVEYLKLKADGLIYCLKEACPNSSASNASGAAAPTLPAHPSTLTHPQRRIDTLNSDGYTPEPARITSPDKPRPMPMDTSVYESPYSDPEELKDKKLFLKRDNLLIADIELGCGNFGSVRQGVYRMRKKQIDVAIKVLKQGTEKADTEEMMREAQIMHQLDNPYIVRLIGVCQAEALMLVMEMAGGGPLHKFLVGKREEIPVSNVAELLHQVSMGMKYLEEKNFVHRDLAARNVLLVNRHYAKISDFGLSKALGADDSYYTARSAGKWPLKWYAPECINFRKFSSRSDVWSYGVTMWEALSYGQKPYKKMKGPEVMAFIEQGKRMECPPECPPELYALMSDCWIYKWEDRPDFLTVEQRMRACYYSLASKVEGPPGSTQKAEAACA DIP protein P43403 original sequence version: 146 DIP protein P43403-1 original sequence version: 167 D1E1A8EC66FA116F lck_human Tyrosine-protein kinase Lck Protein YT16 Proto-oncogene Lck T cell-specific protein-tyrosine kinase LCK Lymphocyte cell-specific protein-tyrosine kinase p56-LCK Leukocyte C-terminal Src kinase protein protein human Homo sapiens Human MGCGCSSHPEDDWMENIDVCENCHYPIVPLDGKGTLLIRNGSEVRDPLVTYEGSNPPASPLQDNLVIALHSYEPSHDGDLGFEKGEQLRILEQSGEWWKAQSLTTGQEGFIPFNFVAKANSLEPEPWFFKNLSRKDAERQLLAPGNTHGSFLIRESESTAGSFSLSVRDFDQNQGEVVKHYKIRNLDNGGFYISPRITFPGLHELVRHYTNASDGLCTRLSRPCQTQKPQKPWWEDEWEVPRETLKLVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDAFLAEANLMKQLQHQRLVRLYAVVTQEPIYIITEYMENGSLVDFLKTPSGIKLTINKLLDMAAQIAEGMAFIEERNYIHRDLRAANILVSDTLSCKIADFGLARLIEDNEYTAREGAKFPIKWTAPEAINYGTFTIKSDVWSFGILLTEIVTHGRIPYPGMTNPEVIQNLERGYRMVRPDNCPEELYQLMRLCWKERPEDRPTFDYLRSVLEDFFTATEGQYQPQP DIP protein P06239 original sequence version: 164 DIP protein P06239-1 original sequence version: 193 44BFF0D43FFB420D p20963-1 T-cell surface glycoprotein CD3 zeta chain CD247 CD3Z T3Z TCRZ CD-3-zeta T-cell receptor T3 zeta chain protein protein human Homo sapiens Human MKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR DIP protein P20963-1 original sequence version: 154 p08575-3 Receptor-type tyrosine-protein phosphatase C CD45RABC PTPRC CD45 Leukocyte common antigen T200 protein protein human Homo sapiens Human MTMYLWLKLLAFGFAFLDTEVFVTGQSPTPSPTGLTTAKMPSVPLSSDPLPTHTTAFSPASTFERENDFSETTTSLSPDNTSTQVSPDSLDNASAFNTTGVSSVQTPHLPTHADSQTPSAGTDTQTFSGSAANAKLNPTPGSNAISDVPGERSTASTFPTDPVSPLTTTLSLAHHSSAALPARTSNTTITANTSDAYLNASETTTLSPSGSAVISTTTIATTPSKPTCDEKYANITVDYLYNKETKLFTAKLNVNENVECGNNTCTNNEVHNLTECKNASVSISHNSCTAPDKTLILDVPPGVEKFQLHDCTQVEKADTTICLKWKNIETFTCDTQNITYRFQCGNMIFDNKEIKLENLEPEHEYKCDSEILYNNHKFTNASKIIKTDFGSPGEPQIIFCRSEAAHQGVITWNPPQRSFHNFTLCYIKETEKDCLNLDKNLIKYDLQNLKPYTKYVLSLHAYIIAKVQRNGSAAMCHFTTKSAPPSQVWNMTVSMTSDNSMHVKCRPPRDRNGPHERYHLEVEAGNTLVRNESHKNCDFRVKDLQYSTDYTFKAYFHNGDYPGEPFILHHSTSYNSKALIAFLAFLIIVTSIALLVVLYKIYDLHKKRSCNLDEQQELVERDDEKQLMNVEPIHADILLETYKRKIADEGRLFLAEFQSIPRVFSKFPIKEARKPFNQNKNRYVDILPYDYNRVELSEINGDAGSNYINASYIDGFKEPRKYIAAQGPRDETVDDFWRMIWEQKATVIVMVTRCEEGNRNKCAEYWPSMEEGTRAFGDVVVKINQHKRCPDYIIQKLNIVNKKEKATGREVTHIQFTSWPDHGVPEDPHLLLKLRRRVNAFSNFFSGPIVVHCSAGVGRTGTYIGIDAMLEGLEAENKVDVYGYVVKLRRQRCLMVQVEAQYILIHQALVEYNQFGETEVNLSELHPYLHNMKKRDPPSEPSPLEAEFQRLPSYRSWRTQHIGNQEENKSKNRNSNVIPYDYNRVPLKHELEMSKESEHDSDESSDDDSDSEEPSKYINASFIMSYWKPEVMIAAQGPLKETIGDFWQMIFQRKVKVIVMLTELKHGDQEICAQYWGEGKQTYGDIEVDLKDTDKSSTYTLRVFELRHSKRKDSRTVYQYQYTNWSVEQLPAEPKELISMIQVVKQKLPQKNSSEGNKHHKSTPLLIHCRDGSQQTGIFCALLNLLESAETEEVVDIFQVVKALRKARPGMVSTFEQYQFLYDVIASTYPAQNGQVKKNNHQEDKIEFDNEVDKVKQDANCVNPLGAPEKLPEAKEQAEGSEPTSGTEGPEHSVNGPASPALNQGS 6E942E2BF6B17AC5 lck-ptprc-10 2 9 enzyme enzyme unspecified role unspecified role Region 598-1304 Region 598-1304 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 7 enzyme target enzyme target substrate substrate unspecified role unspecified role pY505 pY505 optyr O4'-phospho-L-tyrosine (2S)-2-amino-3-(4-phosphonooxyphenyl)propanoic acid 2-azanyl-3-(4-phosphonooxyphenyl)propanoic acid MOD_RES Phosphotyrosine O4-phosphotyrosine tyrosine phosphate 2-amino-3-(4-hydroxyphenyl)propanoic acid 4'-phosphate O4'-phospho-L-tyrosine O4'-phosphorylated L-tyrosine OPTyr Phospho Phospho Tyrosinyl Phosphorylation phosphorylationy certain certain sequence position certain certain certain sequence position certain spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm dephosphorylation dephosphorylation reaction dephosphorylation lck-10 3 7 putative self putative self unspecified role unspecified role pY394/505 pY394/505 optyr O4'-phospho-L-tyrosine (2S)-2-amino-3-(4-phosphonooxyphenyl)propanoic acid 2-azanyl-3-(4-phosphonooxyphenyl)propanoic acid MOD_RES Phosphotyrosine O4-phosphotyrosine tyrosine phosphate 2-amino-3-(4-hydroxyphenyl)propanoic acid 4'-phosphate O4'-phospho-L-tyrosine O4'-phosphorylated L-tyrosine OPTyr Phospho Phospho Tyrosinyl Phosphorylation phosphorylationy western blot western blot Immuno blot Immuno blot certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain pY394/505 pY394/505 optyr O4'-phospho-L-tyrosine (2S)-2-amino-3-(4-phosphonooxyphenyl)propanoic acid 2-azanyl-3-(4-phosphonooxyphenyl)propanoic acid MOD_RES Phosphotyrosine O4-phosphotyrosine tyrosine phosphate 2-amino-3-(4-hydroxyphenyl)propanoic acid 4'-phosphate O4'-phospho-L-tyrosine O4'-phosphorylated L-tyrosine OPTyr Phospho Phospho Tyrosinyl Phosphorylation phosphorylationy modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm phosphorylation phosphorylation reaction phosphorylation true lck-lck-1 5 7 enzyme enzyme unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 7 enzyme target enzyme target substrate substrate unspecified role unspecified role pY394/505 pY394/505 optyr O4'-phospho-L-tyrosine (2S)-2-amino-3-(4-phosphonooxyphenyl)propanoic acid 2-azanyl-3-(4-phosphonooxyphenyl)propanoic acid MOD_RES Phosphotyrosine O4-phosphotyrosine tyrosine phosphate 2-amino-3-(4-hydroxyphenyl)propanoic acid 4'-phosphate O4'-phospho-L-tyrosine O4'-phosphorylated L-tyrosine OPTyr Phospho Phospho Tyrosinyl Phosphorylation phosphorylationy western blot western blot Immuno blot Immuno blot certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain P06239:p.Lys273Arg K273R mutation mutation certain certain sequence position certain certain certain sequence position certain K R This feature has been corrected as a result of our quality control procedures. The original label was 'K273R'. Wed May 02 20:16:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys273arg' Tue Jun 30 17:05:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys273Arg' spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm phosphorylation phosphorylation reaction phosphorylation cd247-lck-1 4 8 enzyme target enzyme target substrate substrate unspecified role unspecified role Region 52-164 Region 52-164 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 7 enzyme enzyme unspecified role unspecified role pY394 pY394 optyr O4'-phospho-L-tyrosine (2S)-2-amino-3-(4-phosphonooxyphenyl)propanoic acid 2-azanyl-3-(4-phosphonooxyphenyl)propanoic acid MOD_RES Phosphotyrosine O4-phosphotyrosine tyrosine phosphate 2-amino-3-(4-hydroxyphenyl)propanoic acid 4'-phosphate O4'-phospho-L-tyrosine O4'-phosphorylated L-tyrosine OPTyr Phospho Phospho Tyrosinyl Phosphorylation phosphorylationy certain certain sequence position certain certain certain sequence position certain increasing-ptm ptm increasing an interaction increasing-ptm pY505 pY505 optyr O4'-phospho-L-tyrosine (2S)-2-amino-3-(4-phosphonooxyphenyl)propanoic acid 2-azanyl-3-(4-phosphonooxyphenyl)propanoic acid MOD_RES Phosphotyrosine O4-phosphotyrosine tyrosine phosphate 2-amino-3-(4-hydroxyphenyl)propanoic acid 4'-phosphate O4'-phospho-L-tyrosine O4'-phosphorylated L-tyrosine OPTyr Phospho Phospho Tyrosinyl Phosphorylation phosphorylationy certain certain sequence position certain certain certain sequence position certain decreasing-ptm ptm decreasing an interaction decreasing-ptm spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm phosphorylation phosphorylation reaction phosphorylation cd247-zap70-23 1 6 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept Region 1-259 Region 1-259 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Rhod-label Rhod-label rhodamine label rhodamine label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 8 unspecified role unspecified role fluorescence donor fluorescence donor Region 52-164 Region 52-164 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain TMR-label TMR-label tetramethyl rhodamine label tetramethyl rhodamine label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli physical association physical association