DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Defining HIV-1 Vif residues that interact with CBFβ by site-directed mutagenesis. Defining HIV-1 Vif residues that interact with CBFβ by site-directed mutagenesis. Virology 2014 imex curation Matsui Y., Shindo K., Nagata K., Io K., Tada K., Iwai F., Kobayashi M., Kadowaki N., Harris RS., Takaori-Kondo A. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Matsui Y., Shindo K., Nagata K., Io K., Tada K., Iwai F., Kobayashi M., Kadowaki N., Harris RS., Takaori-Kondo A. DIP original experiment: DIP-266725X Virology 2014 IMEx Defining HIV-1 Vif residues that interact with CBFβ by site-directed mutagenesis. Defining HIV-1 Vif residues that interact with CBFβ by site-directed mutagenesis. Defining HIV-1 Vif residues that interact with CBFβ by site-directed mutagenesis. Virology 2014 imex curation Matsui Y., Shindo K., Nagata K., Io K., Tada K., Iwai F., Kobayashi M., Kadowaki N., Harris RS., Takaori-Kondo A. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Matsui Y., Shindo K., Nagata K., Io K., Tada K., Iwai F., Kobayashi M., Kadowaki N., Harris RS., Takaori-Kondo A. DIP original experiment: DIP-266724X Virology 2014 IMEx Defining HIV-1 Vif residues that interact with CBFβ by site-directed mutagenesis. Defining HIV-1 Vif residues that interact with CBFβ by site-directed mutagenesis. Defining HIV-1 Vif residues that interact with CBFβ by site-directed mutagenesis. Virology 2014 imex curation Matsui Y., Shindo K., Nagata K., Io K., Tada K., Iwai F., Kobayashi M., Kadowaki N., Harris RS., Takaori-Kondo A. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Matsui Y., Shindo K., Nagata K., Io K., Tada K., Iwai F., Kobayashi M., Kadowaki N., Harris RS., Takaori-Kondo A. DIP original experiment: DIP-266726X Virology 2014 IMEx Defining HIV-1 Vif residues that interact with CBFβ by site-directed mutagenesis. pebb_human Core-binding factor subunit beta Polyomavirus enhancer-binding protein 2 beta subunit SL3-3 enhancer factor 1 subunit beta SL3/AKV core-binding factor beta subunit CBFB protein protein human Homo sapiens Human MPRVVPDQRSKFENEEFFRKLSRECEIKYTGFRDRPHEERQARFQNACRDGRSEIAFVATGTNLSLQFFPASWQGEQRQTPSREYVDLEREAGKVYLKAPMILNGVCVIWKGWIDLQRLDGMGCLEFDEERAQQEDALAQQAFEEARRRTREFEDRDRSHREEMEVRVSQLLAVTGKKTTRP DIP protein Q13951 original sequence version: 131 DIP protein Q13951 original sequence version: 143 DIP protein Q13951 original sequence version: 142 20FB1CC05FBFE4FB q15370-1 Elongin-B ELOB TCEB2 Elongin 18 kDa subunit RNA polymerase II transcription factor SIII subunit B SIII p18 Transcription elongation factor B polypeptide 2 protein protein human Homo sapiens Human MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ DIP protein Q15370-1 original sequence version: 150 DIP protein Q15370 original sequence version: 72 DIP protein Q15370 original sequence version: 134 DIP protein Q15370 original sequence version: 140 DIP protein Q15370 original sequence version: 156 DIP protein Q15370 original sequence version: 152 vif_hv1h2 Virion infectivity factor SOR protein vif protein protein hv1h2 Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) (HIV-1) HIV-1 MENRWQVMIVWQVDRMRIRTWKSLVKHHMYVSGKARGWFYRHHYESPHPRISSEVHIPLGDARLVITTYWGLHTGERDWHLGQGVSIEWRKKRYSTQVDPELADQLIHLYYFDCFSDSAIRKALLGHIVSPRCEYQAGHNKVGSLQYLALAALITPKKIKPPLPSVTKLTEDRWNKPQKTKGHRGSHTMNGH DIP protein P69723 original sequence version: 74 DIP protein P69723 original sequence version: 72 cul5_human Cullin-5 CUL5 VACM1 Vasopressin-activated calcium-mobilizing receptor 1 protein protein human Homo sapiens Human MATSNLLKNKGSLQFEDKWDFMRPIVLKLLRQESVTKQQWFDLFSDVHAVCLWDDKGPAKIHQALKEDILEFIKQAQARVLSHQDDTALLKAYIVEWRKFFTQCDILPKPFCQLEITLMGKQGSNKKSNVEDSIVRKLMLDTWNESIFSNIKNRLQDSAMKLVHAERLGEAFDSQLVIGVRESYVNLCSNPEDKLQIYRDNFEKAYLDSTERFYRTQAPSYLQQNGVQNYMKYADAKLKEEEKRALRYLETRRECNSVEALMECCVNALVTSFKETILAECQGMIKRNETEKLHLMFSLMDKVPNGIEPMLKDLEEHIISAGLADMVAAAETITTDSEKYVEQLLTLFNRFSKLVKEAFQDDPRFLTARDKAYKAVVNDATIFKLELPLKQKGVGLKTQPESKCPELLANYCDMLLRKTPLSKKLTSEEIEAKLKEVLLVLKYVQNKDVFMRYHKAHLTRRLILDISADSEIEENMVEWLREVGMPADYVNKLARMFQDIKVSEDLNQAFKEMHKNNKLALPADSVNIKILNAGAWSRSSEKVFVSLPTELEDLIPEVEEFYKKNHSGRKLHWHHLMSNGIITFKNEVGQYDLEVTTFQLAVLFAWNQRPREKISFENLKLATELPDAELRRTLWSLVAFPKLKRQVLLYEPQVNSPKDFTEGTLFSVNQEFSLIKNAKVQKRGKINLIGRLQLTTERMREEENEGIVQLRILRTQEAIIQIMKMRKKISNAQLQTELVEILKNMFLPQKKMIKEQIEWLIEHKYIRRDESDINTFIYMA DIP protein Q93034 original sequence version: 160 DIP protein Q93034 original sequence version: 128 DIP protein Q93034 original sequence version: 126 DIP protein Q93034 original sequence version: 142 DIP protein Q93034 original sequence version: 96 57463CB4ED76E303 vif-cbfb-5 2 4 unspecified role unspecified role prey prey human Homo sapiens Human 6 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range P69723:p.Trp21Ala W21A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain W A This feature has been corrected as a result of our quality control procedures. The original label was 'W21A'. Wed May 02 18:13:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp21ala' Tue Jun 30 15:38:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp21Ala' P69723:p.Trp89Ala W89A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain W A This feature has been corrected as a result of our quality control procedures. The original label was 'W89A'. Wed May 02 18:18:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp89ala' Tue Jun 30 17:58:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp89Ala' P69723:p.[Glu88Ala;Trp89Ala] E88A/W89A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain W A certain certain sequence position certain certain certain sequence position certain E A This feature has been corrected as a result of our quality control procedures. The original label was 'E88A/W89A'. Wed May 02 20:09:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu88ala,trp89ala' Tue Jun 30 15:57:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Glu88Ala;Trp89Ala]' P69723:p.Trp38Ala W38A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain W A This feature has been corrected as a result of our quality control procedures. The original label was 'W38A'. Wed May 02 14:33:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp38ala' Tue Jun 30 17:04:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp38Ala' P69723:p.Tyr69Ala Y69A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Y A This feature has been corrected as a result of our quality control procedures. The original label was 'Y69A'. Wed May 02 19:32:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr69ala' Tue Jun 30 15:43:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr69Ala' human Homo sapiens Human physical association physical association vif-elob-1 3 5 unspecified role unspecified role prey prey human Homo sapiens Human 6 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human physical association physical association vif-cul5-1 1 7 unspecified role unspecified role prey prey human Homo sapiens Human 6 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range P69723:p.Trp21Ala W21A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain W A This feature has been corrected as a result of our quality control procedures. The original label was 'W21A'. Wed May 02 15:45:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp21ala' Tue Jun 30 18:09:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp21Ala' P69723:p.Trp89Ala W89A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain W A This feature has been corrected as a result of our quality control procedures. The original label was 'W89A'. Wed May 02 17:43:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp89ala' Tue Jun 30 20:14:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp89Ala' P69723:p.[Glu88Ala;Trp89Ala] E88A/W89A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain W A certain certain sequence position certain certain certain sequence position certain E A This feature has been corrected as a result of our quality control procedures. The original label was 'E88A/W89A'. Wed May 02 18:10:11 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu88ala,trp89ala' Tue Jun 30 17:06:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Glu88Ala;Trp89Ala]' P69723:p.Trp38Ala W38A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain W A This feature has been corrected as a result of our quality control procedures. The original label was 'W38A'. Wed May 02 16:14:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp38ala' Tue Jun 30 18:51:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp38Ala' human Homo sapiens Human physical association physical association