DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu NleH defines a new family of bacterial effector kinases. NleH defines a new family of bacterial effector kinases. Structure (London, England : 1993) 2014 imex curation Grishin AM., Cherney M., Anderson DH., Phanse S., Babu M., Cygler M. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Grishin AM., Cherney M., Anderson DH., Phanse S., Babu M., Cygler M. DIP original experiment: DIP-259668X Structure (London, England : 1993) 2014 IMEx NleH defines a new family of bacterial effector kinases. NleH defines a new family of bacterial effector kinases. NleH defines a new family of bacterial effector kinases. Structure (London, England : 1993) 2014 imex curation Grishin AM., Cherney M., Anderson DH., Phanse S., Babu M., Cygler M. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Grishin AM., Cherney M., Anderson DH., Phanse S., Babu M., Cygler M. DIP original experiment: DIP-259667X Structure (London, England : 1993) 2014 IMEx NleH defines a new family of bacterial effector kinases. q8x831_eco57 nleH1-1 ECs_0848 E5F08_07760 protein protein eco57 Escherichia coli O157:H7 MLSPYSVNLGCSWNSLTRNLTSPDNRVLSSVRDAAVHSDNGAQVKVGNRTYRVVATDNKFCVTRESHSGCFTNLLHRLGWPKGEISRKIEVMLNASPVSAAMERGIVHSNRPDLPPVDYAPPELPSVDYNRLSVPGNVIGKGGNAVVYEDAEDATKVLKMFTTSQSNEEVTSEVRCFNQYYGAGSAEKIYGNNGDIIGIRMDKINGESLLNISSLPAQAEHAIYDMFDRLEQKGILFVDTTETNVLYDRAKNEFNPIDISSYNVSDRSWSESQIMQSYHGGKQDLISVVLSKI DIP protein Q8X831 original sequence version: 57 q8xal6_eco57 E5F08_14920 nleH1_2 ECs_1814 protein protein eco57 Escherichia coli O157:H7 MLSPSSINLGCSWNSLTRNLTSPDNRVLSSVRDAAVHSDSGTQVTVGNRTYRVVVTDNKFCVTRESHSGCFTNLLHRLGWPKGEISRKIEAMLNTSPVSTTIERGSVHSNRPDLPPVDYAQPELPPADYTQSELPRVSNNKSPVPGNVIGKGGNAVVYEDMEDTTKVLKMFTISQSHEEVTSEVRCFNQYYGSGSAEKIYNDNGNVIGIRMNKINGESLLDIPSLPAQAEQAIYDMFDRLEKKGILFVDTTETNVLYDRMRNEFNPIDISSYNVSDISWSEHQVMQSYHGGKLDLISVVLSKI DIP protein Q8XAL6 original sequence version: 55 89B94F236CBF9AAF q8x831_eco57-1 2 3 putative self putative self unspecified role unspecified role Region 40-293 Region 40-293 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli phosphorylation phosphorylation reaction phosphorylation true q8xal6_eco57-1 1 4 putative self putative self unspecified role unspecified role ecolx Escherichia coli phosphorylation phosphorylation reaction phosphorylation true