DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu A secreted peptide acts on BIN2-mediated phosphorylation of ARFs to potentiate auxin response during lateral root development. A secreted peptide acts on BIN2-mediated phosphorylation of ARFs to potentiate auxin response during lateral root development. Nature cell biology 2014 imex curation Cho H., Ryu H., Rho S., Hill K., Smith S., Audenaert D., Park J., Han S., Beeckman T., Bennett MJ., Hwang D., De Smet I., Hwang I. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Cho H., Ryu H., Rho S., Hill K., Smith S., Audenaert D., Park J., Han S., Beeckman T., Bennett MJ., Hwang D., De Smet I., Hwang I. DIP original experiment: DIP-260077X Nature cell biology 2014 IMEx A secreted peptide acts on BIN2-mediated phosphorylation of ARFs to potentiate auxin response during lateral root development. A secreted peptide acts on BIN2-mediated phosphorylation of ARFs to potentiate auxin response during lateral root development. A secreted peptide acts on BIN2-mediated phosphorylation of ARFs to potentiate auxin response during lateral root development. Nature cell biology 2014 imex curation Cho H., Ryu H., Rho S., Hill K., Smith S., Audenaert D., Park J., Han S., Beeckman T., Bennett MJ., Hwang D., De Smet I., Hwang I. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Cho H., Ryu H., Rho S., Hill K., Smith S., Audenaert D., Park J., Han S., Beeckman T., Bennett MJ., Hwang D., De Smet I., Hwang I. DIP original experiment: DIP-260080X Nature cell biology 2014 IMEx A secreted peptide acts on BIN2-mediated phosphorylation of ARFs to potentiate auxin response during lateral root development. A secreted peptide acts on BIN2-mediated phosphorylation of ARFs to potentiate auxin response during lateral root development. A secreted peptide acts on BIN2-mediated phosphorylation of ARFs to potentiate auxin response during lateral root development. Nature cell biology 2014 imex curation Cho H., Ryu H., Rho S., Hill K., Smith S., Audenaert D., Park J., Han S., Beeckman T., Bennett MJ., Hwang D., De Smet I., Hwang I. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Cho H., Ryu H., Rho S., Hill K., Smith S., Audenaert D., Park J., Han S., Beeckman T., Bennett MJ., Hwang D., De Smet I., Hwang I. DIP original experiment: DIP-260082X Nature cell biology 2014 IMEx A secreted peptide acts on BIN2-mediated phosphorylation of ARFs to potentiate auxin response during lateral root development. A secreted peptide acts on BIN2-mediated phosphorylation of ARFs to potentiate auxin response during lateral root development. A secreted peptide acts on BIN2-mediated phosphorylation of ARFs to potentiate auxin response during lateral root development. Nature cell biology 2014 imex curation Cho H., Ryu H., Rho S., Hill K., Smith S., Audenaert D., Park J., Han S., Beeckman T., Bennett MJ., Hwang D., De Smet I., Hwang I. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Cho H., Ryu H., Rho S., Hill K., Smith S., Audenaert D., Park J., Han S., Beeckman T., Bennett MJ., Hwang D., De Smet I., Hwang I. DIP original experiment: DIP-260084X Nature cell biology 2014 IMEx A secreted peptide acts on BIN2-mediated phosphorylation of ARFs to potentiate auxin response during lateral root development. A secreted peptide acts on BIN2-mediated phosphorylation of ARFs to potentiate auxin response during lateral root development. A secreted peptide acts on BIN2-mediated phosphorylation of ARFs to potentiate auxin response during lateral root development. Nature cell biology 2014 imex curation Cho H., Ryu H., Rho S., Hill K., Smith S., Audenaert D., Park J., Han S., Beeckman T., Bennett MJ., Hwang D., De Smet I., Hwang I. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Cho H., Ryu H., Rho S., Hill K., Smith S., Audenaert D., Park J., Han S., Beeckman T., Bennett MJ., Hwang D., De Smet I., Hwang I. DIP original experiment: DIP-260081X Nature cell biology 2014 IMEx A secreted peptide acts on BIN2-mediated phosphorylation of ARFs to potentiate auxin response during lateral root development. A secreted peptide acts on BIN2-mediated phosphorylation of ARFs to potentiate auxin response during lateral root development. A secreted peptide acts on BIN2-mediated phosphorylation of ARFs to potentiate auxin response during lateral root development. Nature cell biology 2014 imex curation Cho H., Ryu H., Rho S., Hill K., Smith S., Audenaert D., Park J., Han S., Beeckman T., Bennett MJ., Hwang D., De Smet I., Hwang I. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Cho H., Ryu H., Rho S., Hill K., Smith S., Audenaert D., Park J., Han S., Beeckman T., Bennett MJ., Hwang D., De Smet I., Hwang I. DIP original experiment: DIP-260078X Nature cell biology 2014 IMEx A secreted peptide acts on BIN2-mediated phosphorylation of ARFs to potentiate auxin response during lateral root development. A secreted peptide acts on BIN2-mediated phosphorylation of ARFs to potentiate auxin response during lateral root development. A secreted peptide acts on BIN2-mediated phosphorylation of ARFs to potentiate auxin response during lateral root development. Nature cell biology 2014 imex curation Cho H., Ryu H., Rho S., Hill K., Smith S., Audenaert D., Park J., Han S., Beeckman T., Bennett MJ., Hwang D., De Smet I., Hwang I. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Cho H., Ryu H., Rho S., Hill K., Smith S., Audenaert D., Park J., Han S., Beeckman T., Bennett MJ., Hwang D., De Smet I., Hwang I. DIP original experiment: DIP-260073X Nature cell biology 2014 IMEx A secreted peptide acts on BIN2-mediated phosphorylation of ARFs to potentiate auxin response during lateral root development. A secreted peptide acts on BIN2-mediated phosphorylation of ARFs to potentiate auxin response during lateral root development. A secreted peptide acts on BIN2-mediated phosphorylation of ARFs to potentiate auxin response during lateral root development. Nature cell biology 2014 imex curation Cho H., Ryu H., Rho S., Hill K., Smith S., Audenaert D., Park J., Han S., Beeckman T., Bennett MJ., Hwang D., De Smet I., Hwang I. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Cho H., Ryu H., Rho S., Hill K., Smith S., Audenaert D., Park J., Han S., Beeckman T., Bennett MJ., Hwang D., De Smet I., Hwang I. DIP original experiment: DIP-260074X Nature cell biology 2014 IMEx A secreted peptide acts on BIN2-mediated phosphorylation of ARFs to potentiate auxin response during lateral root development. A secreted peptide acts on BIN2-mediated phosphorylation of ARFs to potentiate auxin response during lateral root development. A secreted peptide acts on BIN2-mediated phosphorylation of ARFs to potentiate auxin response during lateral root development. Nature cell biology 2014 imex curation Cho H., Ryu H., Rho S., Hill K., Smith S., Audenaert D., Park J., Han S., Beeckman T., Bennett MJ., Hwang D., De Smet I., Hwang I. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Cho H., Ryu H., Rho S., Hill K., Smith S., Audenaert D., Park J., Han S., Beeckman T., Bennett MJ., Hwang D., De Smet I., Hwang I. DIP original experiment: DIP-260083X Nature cell biology 2014 IMEx A secreted peptide acts on BIN2-mediated phosphorylation of ARFs to potentiate auxin response during lateral root development. A secreted peptide acts on BIN2-mediated phosphorylation of ARFs to potentiate auxin response during lateral root development. A secreted peptide acts on BIN2-mediated phosphorylation of ARFs to potentiate auxin response during lateral root development. Nature cell biology 2014 imex curation Cho H., Ryu H., Rho S., Hill K., Smith S., Audenaert D., Park J., Han S., Beeckman T., Bennett MJ., Hwang D., De Smet I., Hwang I. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Cho H., Ryu H., Rho S., Hill K., Smith S., Audenaert D., Park J., Han S., Beeckman T., Bennett MJ., Hwang D., De Smet I., Hwang I. DIP original experiment: DIP-260075X Nature cell biology 2014 IMEx A secreted peptide acts on BIN2-mediated phosphorylation of ARFs to potentiate auxin response during lateral root development. A secreted peptide acts on BIN2-mediated phosphorylation of ARFs to potentiate auxin response during lateral root development. A secreted peptide acts on BIN2-mediated phosphorylation of ARFs to potentiate auxin response during lateral root development. Nature cell biology 2014 imex curation Cho H., Ryu H., Rho S., Hill K., Smith S., Audenaert D., Park J., Han S., Beeckman T., Bennett MJ., Hwang D., De Smet I., Hwang I. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Cho H., Ryu H., Rho S., Hill K., Smith S., Audenaert D., Park J., Han S., Beeckman T., Bennett MJ., Hwang D., De Smet I., Hwang I. DIP original experiment: DIP-260076X Nature cell biology 2014 IMEx A secreted peptide acts on BIN2-mediated phosphorylation of ARFs to potentiate auxin response during lateral root development. A secreted peptide acts on BIN2-mediated phosphorylation of ARFs to potentiate auxin response during lateral root development. A secreted peptide acts on BIN2-mediated phosphorylation of ARFs to potentiate auxin response during lateral root development. Nature cell biology 2014 imex curation Cho H., Ryu H., Rho S., Hill K., Smith S., Audenaert D., Park J., Han S., Beeckman T., Bennett MJ., Hwang D., De Smet I., Hwang I. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Cho H., Ryu H., Rho S., Hill K., Smith S., Audenaert D., Park J., Han S., Beeckman T., Bennett MJ., Hwang D., De Smet I., Hwang I. DIP original experiment: DIP-260079X Nature cell biology 2014 IMEx A secreted peptide acts on BIN2-mediated phosphorylation of ARFs to potentiate auxin response during lateral root development. tir1_arath Protein TRANSPORT INHIBITOR RESPONSE 1 TIR1 FBL1 WEI1 T20O10.80 At3g62980 Weak ethylene-insensitive protein 1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MQKRIALSFPEEVLEHVFSFIQLDKDRNSVSLVCKSWYEIERWCRRKVFIGNCYAVSPATVIRRFPKVRSVELKGKPHFADFNLVPDGWGGYVYPWIEAMSSSYTWLEEIRLKRMVVTDDCLELIAKSFKNFKVLVLSSCEGFSTDGLAAIAATCRNLKELDLRESDVDDVSGHWLSHFPDTYTSLVSLNISCLASEVSFSALERLVTRCPNLKSLKLNRAVPLEKLATLLQRAPQLEELGTGGYTAEVRPDVYSGLSVALSGCKELRCLSGFWDAVPAYLPAVYSVCSRLTTLNLSYATVQSYDLVKLLCQCPKLQRLWVLDYIEDAGLEVLASTCKDLRELRVFPSEPFVMEPNVALTEQGLVSVSMGCPKLESVLYFCRQMTNAALITIARNRPNMTRFRLCIIEPKAPDYLTLEPLDIGFGAIVEHCKDLRRLSLSGLLTDKVFEYIGTYAKKMEMLSVAFAGDSDLGMHHVLSGCDSLRKLEIRDCPFGDKALLANASKLETMRSLWMSSCSVSFGACKLLGQKMPKLNVEVIDERGAPDSRPESCPVERVFIYRTVAGPRFDMPGFVWNMDQDSTMRFSRQIITTNGL DIP protein Q570C0 original sequence version: 83 DIP protein Q570C0 original sequence version: 40 DIP protein Q570C0 original sequence version: 86 DIP protein Q570C0 original sequence version: 60 9E19ED5DABF40D07 ksg7_arath Shaggy-related protein kinase eta ASK7 BIN2 DWF12 UCU1 ASK-eta Protein BRASSINOSTEROID INSENSITIVE 2 Protein ULTRACURVATA 1 F28A21.120 At4g18710 SK21 Shaggy-related protein kinase 21 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MADDKEMPAAVVDGHDQVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCLETGETVAIKKVLQDRRYKNRELQLMRVMDHPNVVCLKHCFFSTTSKDELFLNLVMEYVPESLYRVLKHYSSANQRMPLVYVKLYMYQIFRGLAYIHNVAGVCHRDLKPQNLLVDPLTHQVKICDFGSAKQLVKGEANISYICSRFYRAPELIFGATEYTTSIDIWSAGCVLAELLLGQPLFPGENAVDQLVEIIKVLGTPTREEIRCMNPHYTDFRFPQIKAHPWHKIFHKRMPPEAIDFASRLLQYSPSLRCTALEACAHPFFDELREPNARLPNGRPFPPLFNFKQEVAGSSPELVNKLIPDHIKRQLGLSFLNQSGT DIP protein Q39011 original sequence version: 100 DIP protein Q39011 original sequence version: 121 DIP protein Q39011 original sequence version: 146 DIP protein Q39011 original sequence version: 129 DIP protein Q39011 original sequence version: 113 86C2FD5F77201168 arfs_arath Auxin response factor 19 Auxin-responsive protein IAA22 ARF19 IAA22 At1g19220 T29M8.9 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MKAPSNGFLPSSNEGEKKPINSQLWHACAGPLVSLPPVGSLVVYFPQGHSEQVAASMQKQTDFIPNYPNLPSKLICLLHSVTLHADTETDEVYAQMTLQPVNKYDREALLASDMGLKLNRQPTEFFCKTLTASDTSTHGGFSVPRRAAEKIFPPLDFSMQPPAQEIVAKDLHDTTWTFRHIYRGQPKRHLLTTGWSVFVSTKRLFAGDSVLFVRDEKSQLMLGIRRANRQTPTLSSSVISSDSMHIGILAAAAHANANSSPFTIFFNPRASPSEFVVPLAKYNKALYAQVSLGMRFRMMFETEDCGVRRYMGTVTGISDLDPVRWKGSQWRNLQVGWDESTAGDRPSRVSIWEIEPVITPFYICPPPFFRPKYPRQPGMPDDELDMENAFKRAMPWMGEDFGMKDAQSSMFPGLSLVQWMSMQQNNPLSGSATPQLPSALSSFNLPNNFASNDPSKLLNFQSPNLSSANSQFNKPNTVNHISQQMQAQPAMVKSQQQQQQQQQQHQHQQQQLQQQQQLQMSQQQVQQQGIYNNGTIAVANQVSCQSPNQPTGFSQSQLQQQSMLPTGAKMTHQNINSMGNKGLSQMTSFAQEMQFQQQLEMHNSSQLLRNQQEQSSLHSLQQNLSQNPQQLQMQQQSSKPSPSQQLQLQLLQKLQQQQQQQSIPPVSSSLQPQLSALQQTQSHQLQQLLSSQNQQPLAHGNNSFPASTFMQPPQIQVSPQQQGQMSNKNLVAAGRSHSGHTDGEAPSCSTSPSANNTGHDNVSPTNFLSRNQQQGQAASVSASDSVFERASNPVQELYTKTESRISQGMMNMKSAGEHFRFKSAVTDQIDVSTAGTTYCPDVVGPVQQQQTFPLPSFGFDGDCQSHHPRNNLAFPGNLEAVTSDPLYSQKDFQNLVPNYGNTPRDIETELSSAAISSQSFGIPSIPFKPGCSNEVGGINDSGIMNGGGLWPNQTQRMRTYTKVQKRGSVGRSIDVTRYSGYDELRHDLARMFGIEGQLEDPLTSDWKLVYTDHENDILLVGDDPWEEFVNCVQNIKILSSVEVQQMSLDGDLAAIPTTNQACSETDSGNAWKVHYEDTSAAASFNR DIP protein Q8RYC8 original sequence version: 93 202C0944581E0545 iaa18_arath Auxin-responsive protein IAA18 IAA18 Indoleacetic acid-induced protein 18 T14L22.14 At1g51950 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEGYSRNGEISPKLLDLMIPQERRNWFHDEKNSVFKTEEKKLELKLGPPGEEDDDESMIRHMKKEPKDKSILSLAGKYFSPSSTKTTSHKRTAPGPVVGWPPVRSFRKNLASGSSSKLGNDSTTSNGVTLKNQKCDAAAKTTEPKRQGGMFVKINMYGVPIGRKVDLSAHNSYEQLSFTVDKLFRGLLAAQRDFPSSIEDEKPITGLLDGNGEYTLTYEDNEGDKMLVGDVPWQMFVSSVKRLRVIKTSEISSALTYGNGKQEKMRR DIP protein O24408 original sequence version: 95 F1DC7E50172B7B10 iaa19_arath Auxin-responsive protein IAA19 Indoleacetic acid-induced protein 19 Protein MASSUGU 2 IAA19 MSG2 At3g15540 MJK13.20 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEKEGLGLEITELRLGLPGRDVAEKMMKKRAFTEMNMTSSGSNSDQCESGVVSSGGDAEKVNDSPAAKSQVVGWPPVCSYRKKNSCKEASTTKVGLGYVKVSMDGVPYLRKMDLGSSQGYDDLAFALDKLFGFRGIGVALKDGDNCEYVTIYEDKDGDWMLAGDVPWGMFLESCKRLRIMKRSDATGFGLQPRGVDE DIP protein O24409 original sequence version: 103 84B332B780132B53 tdr_arath Leucine-rich repeat receptor-like protein kinase TDR TDR PXY Protein PHLOEM INTERCALATED WITH XYLEM Tracheary element differentiation inhibitory factor receptor MCI2.4 At5g61480 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MKKKNISPSLVLHPLLLLLLPFFAFNSLALKFSPQLLSLLSLKTSLSGPPSAFQDWKVPVNGQNDAVWCSWSGVVCDNVTAQVISLDLSHRNLSGRIPIQIRYLSSLLYLNLSGNSLEGSFPTSIFDLTKLTTLDISRNSFDSSFPPGISKLKFLKVFNAFSNNFEGLLPSDVSRLRFLEELNFGGSYFEGEIPAAYGGLQRLKFIHLAGNVLGGKLPPRLGLLTELQHMEIGYNHFNGNIPSEFALLSNLKYFDVSNCSLSGSLPQELGNLSNLETLFLFQNGFTGEIPESYSNLKSLKLLDFSSNQLSGSIPSGFSTLKNLTWLSLISNNLSGEVPEGIGELPELTTLFLWNNNFTGVLPHKLGSNGKLETMDVSNNSFTGTIPSSLCHGNKLYKLILFSNMFEGELPKSLTRCESLWRFRSQNNRLNGTIPIGFGSLRNLTFVDLSNNRFTDQIPADFATAPVLQYLNLSTNFFHRKLPENIWKAPNLQIFSASFSNLIGEIPNYVGCKSFYRIELQGNSLNGTIPWDIGHCEKLLCLNLSQNHLNGIIPWEISTLPSIADVDLSHNLLTGTIPSDFGSSKTITTFNVSYNQLIGPIPSGSFAHLNPSFFSSNEGLCGDLVGKPCNSDRFNAGNADIDGHHKEERPKKTAGAIVWILAAAIGVGFFVLVAATRCFQKSYGNRVDGGGRNGGDIGPWKLTAFQRLNFTADDVVECLSKTDNILGMGSTGTVYKAEMPNGEIIAVKKLWGKNKENGKIRRRKSGVLAEVDVLGNVRHRNIVRLLGCCTNRDCTMLLYEYMPNGSLDDLLHGGDKTMTAAAEWTALYQIAIGVAQGICYLHHDCDPVIVHRDLKPSNILLDADFEARVADFGVAKLIQTDESMSVVAGSYGYIAPEYAYTLQVDKKSDIYSYGVILLEIITGKRSVEPEFGEGNSIVDWVRSKLKTKEDVEEVLDKSMGRSCSLIREEMKQMLRIALLCTSRSPTDRPPMRDVLLILQEAKPKRKTVGDNVIVVGDVNDVNFEDVCSVDVGHDVKCQRIGV DIP protein Q9FII5 original sequence version: 55 DIP protein Q9FII5 original sequence version: 116 DIP protein Q9FII5 original sequence version: 97 iaa1_arath Auxin-responsive protein IAA1 Indoleacetic acid-induced protein 1 IAA1 At4g14560 dl3320w FCAALL.409 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEVTNGLNLKDTELRLGLPGAQEEQQLELSCVRSNNKRKNNDSTEESAPPPAKTQIVGWPPVRSNRKNNNNKNVSYVKVSMDGAPYLRKIDLKMYKNYPELLKALENMFKFTVGEYSEREGYKGSGFVPTYEDKDGDWMLVGDVPWDMFSSSCQKLRIMKGSEAPTAL DIP protein P49677 original sequence version: 105 17CA9B3BEB7962EE iaa3_arath Auxin-responsive protein IAA3 IAA3 SHY2 At1g04240 F19P19.32 Indoleacetic acid-induced protein 3 Short hypocotyl Suppressor of HY2 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDEFVNLKETELRLGLPGTDNVCEAKERVSCCNNNNKRVLSTDTEKEIESSSRKTETSPPRKAQIVGWPPVRSYRKNNIQSKKNESEHEGQGIYVKVSMDGAPYLRKIDLSCYKGYSELLKALEVMFKFSVGEYFERDGYKGSDFVPTYEDKDGDWMLIGDVPWEMFICTCKRLRIMKGSEAKGLGCGV DIP protein Q38822 original sequence version: 82 DIP protein Q38822 original sequence version: 104 8627A4173363EF27 iaa14_arath Auxin-responsive protein IAA14 IAA14 SLR1 Indoleacetic acid-induced protein 14 Protein SOLITARY ROOT dl3315c FCAALL.254 At4g14550 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MNLKETELCLGLPGGTETVESPAKSGVGNKRGFSETVDLKLNLQSNKQGHVDLNTNGAPKEKTFLKDPSKPPAKAQVVGWPPVRNYRKNVMANQKSGEAEEAMSSGGGTVAFVKVSMDGAPYLRKVDLKMYTSYKDLSDALAKMFSSFTMGSYGAQGMIDFMNESKVMDLLNSSEYVPSYEDKDGDWMLVGDVPWPMFVESCKRLRIMKGSEAIGLAPRAMEKFKNRS DIP protein Q38832 original sequence version: 90 A76A9F733538E372 arfg_arath Auxin response factor 7 Auxin-responsive protein IAA21/IAA23/IAA25 TIR5 Protein BIPOSTO ARF7 BIP IAA21 IAA23 IAA25 NPH4 At5g20730 T1M15.130 Protein NON-PHOTOTROPIC HYPOCOTYL 4 Protein TRANSPORT INHIBITOR RESPONSE 5 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MKAPSSNGVSPNPVEGERRNINSELWHACAGPLISLPPAGSLVVYFPQGHSEQVAASMQKQTDFIPSYPNLPSKLICMLHNVTLNADPETDEVYAQMTLQPVNKYDRDALLASDMGLKLNRQPNEFFCKTLTASDTSTHGGFSVPRRAAEKIFPALDFSMQPPCQELVAKDIHDNTWTFRHIYRGQPKRHLLTTGWSVFVSTKRLFAGDSVLFIRDGKAQLLLGIRRANRQQPALSSSVISSDSMHIGVLAAAAHANANNSPFTIFYNPRAAPAEFVVPLAKYTKAMYAQVSLGMRFRMIFETEECGVRRYMGTVTGISDLDPVRWKNSQWRNLQIGWDESAAGDRPSRVSVWDIEPVLTPFYICPPPFFRPRFSGQPGMPDDETDMESALKRAMPWLDNSLEMKDPSSTIFPGLSLVQWMNMQQQNGQLPSAAAQPGFFPSMLSPTAALHNNLGGTDDPSKLLSFQTPHGGISSSNLQFNKQNQQAPMSQLPQPPTTLSQQQQLQQLLHSSLNHQQQQSQSQQQQQQQQLLQQQQQLQSQQHSNNNQSQSQQQQQLLQQQQQQQLQQQHQQPLQQQTQQQQLRTQPLQSHSHPQPQQLQQHKLQQLQVPQNQLYNGQQAAQQHQSQQASTHHLQPQLVSGSMASSVITPPSSSLNQSFQQQQQQSKQLQQAHHHLGASTSQSSVIETSKSSSNLMSAPPQETQFSRQVEQQQPPGLNGQNQQTLLQQKAHQAQAQQIFQQSLLEQPHIQFQLLQRLQQQQQQQFLSPQSQLPHHQLQSQQLQQLPTLSQGHQFPSSCTNNGLSTLQPPQMLVSRPQEKQNPPVGGGVKAYSGITDGGDAPSSSTSPSTNNCQISSSGFLNRSQSGPAILIPDAAIDMSGNLVQDLYSKSDMRLKQELVGQQKSKASLTDHQLEASASGTSYGLDGGENNRQQNFLAPTFGLDGDSRNSLLGGANVDNGFVPDTLLSRGYDSQKDLQNMLSNYGGVTNDIGTEMSTSAVRTQSFGVPNVPAISNDLAVNDAGVLGGGLWPAQTQRMRTYTKVQKRGSVGRSIDVNRYRGYDELRHDLARMFGIEGQLEDPQTSDWKLVYVDHENDILLVGDDPWEEFVNCVQSIKILSSAEVQQMSLDGNFAGVPVTNQACSGGDSGNAWRGHYDDNSATSFNR DIP protein P93022 original sequence version: 114 6A2858510130F5B1 ask7-arf7-1 7 22 unspecified role unspecified role prey prey Region 479-1120 Region 479-1120 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 14 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association arf7-ask7-1 10 22 enzyme target enzyme target substrate substrate unspecified role unspecified role GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Region 479-1120 Region 479-1120 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain pS698/707 pS698/707 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 14 enzyme enzyme unspecified role unspecified role GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli phosphorylation phosphorylation reaction phosphorylation iaa19-arf7-1 1 17 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 22 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association ask7-tdr-1 12 18 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 14 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association iaa3-arf7-1 5 20 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 22 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association iaa18-arf7-1 9 16 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 22 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association ask7-arf19-1 8 15 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 14 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association ask7-tdr-2 6 18 unspecified role unspecified role prey prey Region 719-1001 Region 719-1001 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 14 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association iaa1-arf7-1 2 19 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 22 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association iaa14-arf7-2 3 21 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 22 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association ask7-4 11 14 putative self putative self unspecified role unspecified role GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli phosphorylation phosphorylation reaction phosphorylation true iaa19-arf7-2 4 13 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 17 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 22 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress association association