DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Architecture of a dsDNA viral capsid in complex with its maturation protease. Architecture of a dsDNA viral capsid in complex with its maturation protease. Structure (London, England : 1993) 2014 imex curation Veesler D., Khayat R., Krishnamurthy S., Snijder J., Huang RK., Heck AJ., Anand GS., Johnson JE. Only protein-protein interactions ecolx Escherichia coli h1-h2 ms mass spectrometry study of hydrogen/deuterium exchange h1-h2 ms predetermined predetermined participant predetermined Veesler D., Khayat R., Krishnamurthy S., Snijder J., Huang RK., Heck AJ., Anand GS., Johnson JE. DIP original experiment: DIP-259663X Structure (London, England : 1993) 2014 IMEx Architecture of a dsDNA viral capsid in complex with its maturation protease. Architecture of a dsDNA viral capsid in complex with its maturation protease. Architecture of a dsDNA viral capsid in complex with its maturation protease. Structure (London, England : 1993) 2014 imex curation Veesler D., Khayat R., Krishnamurthy S., Snijder J., Huang RK., Heck AJ., Anand GS., Johnson JE. Only protein-protein interactions ecolx Escherichia coli 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Veesler D., Khayat R., Krishnamurthy S., Snijder J., Huang RK., Heck AJ., Anand GS., Johnson JE. DIP original experiment: DIP-259661X Structure (London, England : 1993) 2014 IMEx Architecture of a dsDNA viral capsid in complex with its maturation protease. Architecture of a dsDNA viral capsid in complex with its maturation protease. Architecture of a dsDNA viral capsid in complex with its maturation protease. Structure (London, England : 1993) 2014 imex curation Veesler D., Khayat R., Krishnamurthy S., Snijder J., Huang RK., Heck AJ., Anand GS., Johnson JE. Only protein-protein interactions ecolx Escherichia coli ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Veesler D., Khayat R., Krishnamurthy S., Snijder J., Huang RK., Heck AJ., Anand GS., Johnson JE. DIP original experiment: DIP-259662X Structure (London, England : 1993) 2014 IMEx Architecture of a dsDNA viral capsid in complex with its maturation protease. Architecture of a dsDNA viral capsid in complex with its maturation protease. Architecture of a dsDNA viral capsid in complex with its maturation protease. Structure (London, England : 1993) 2014 imex curation Veesler D., Khayat R., Krishnamurthy S., Snijder J., Huang RK., Heck AJ., Anand GS., Johnson JE. Only protein-protein interactions ecolx Escherichia coli ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Veesler D., Khayat R., Krishnamurthy S., Snijder J., Huang RK., Heck AJ., Anand GS., Johnson JE. DIP original experiment: DIP-259660X Structure (London, England : 1993) 2014 IMEx Architecture of a dsDNA viral capsid in complex with its maturation protease. Architecture of a dsDNA viral capsid in complex with its maturation protease. Architecture of a dsDNA viral capsid in complex with its maturation protease. Structure (London, England : 1993) 2014 imex curation Veesler D., Khayat R., Krishnamurthy S., Snijder J., Huang RK., Heck AJ., Anand GS., Johnson JE. Only protein-protein interactions ecolx Escherichia coli 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Veesler D., Khayat R., Krishnamurthy S., Snijder J., Huang RK., Heck AJ., Anand GS., Johnson JE. DIP original experiment: DIP-259659X Structure (London, England : 1993) 2014 IMEx Architecture of a dsDNA viral capsid in complex with its maturation protease. pro_bphk7 Prohead protease 4 GP4 protein protein bphk7 Enterobacteria phage HK97 Bacteriophage HK97 MPEIVKTLSFDETEIKFTGDGKQGIFEGYASVFNNTDSDGDIILPGAFKNALANQTRKVAMFFNHKTWELPVGKWDSLAEDEKGLYVRGQLTPGHSGAADLKAAMQHGTVEGMSVGFSVAKDDYTIIPTGRIFKNIQALREISVCTFPANEQAGIAAMKSVDGIETIRDVENWLRDSVGLTKSQAVGLIARFKSAIRSESEGDGNEAQINALLQSIKSFPSNLGK DIP protein P49860 original sequence version: 44 capsd_bphk7 Major capsid protein Gene product 5 Major head protein 5 protein protein bphk7 Enterobacteria phage HK97 Bacteriophage HK97 MSELALIQKAIEESQQKMTQLFDAQKAEIESTGQVSKQLQSDLMKVQEELTKSGTRLFDLEQKLASGAENPGEKKSFSERAAEELIKSWDGKQGTFGAKTFNKSLGSDADSAGSLIQPMQIPGIIMPGLRRLTIRDLLAQGRTSSNALEYVREEVFTNNADVVAEKALKPESDITFSKQTANVKTIAHWVQASRQVMDDAPMLQSYINNRLMYGLALKEEGQLLNGDGTGDNLEGLNKVATAYDTSLNATGDTRADIIAHAIYQVTESEFSASGIVLNPRDWHNIALLKDNEGRYIFGGPQAFTSNIMWGLPVVPTKAQAAGTFTVGGFDMASQVWDRMDATVEVSREDRDNFVKNMLTILCEERLALAHYRPTAIIKGTFSSGS DIP protein P49861 original sequence version: 46 DIP protein P49861 original sequence version: 60 DIP protein P49861 original sequence version: 77 DIP protein P49861 original sequence version: 81 DIP protein P49861 original sequence version: 76 5-9 5 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction 4-5 1 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction 5-10 4 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction 4-2 2 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction 4-3 3 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction