DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu A downy mildew effector attenuates salicylic acid-triggered immunity in Arabidopsis by interacting with the host mediator complex. A downy mildew effector attenuates salicylic acid-triggered immunity in Arabidopsis by interacting with the host mediator complex. PLoS biology 2013 imex curation Caillaud MC., Asai S., Rallapalli G., Piquerez S., Fabro G., Jones JD. Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Caillaud MC., Asai S., Rallapalli G., Piquerez S., Fabro G., Jones JD. DIP original experiment: DIP-256132X PLoS biology 2013 IMEx A downy mildew effector attenuates salicylic acid-triggered immunity in Arabidopsis by interacting with the host mediator complex. A downy mildew effector attenuates salicylic acid-triggered immunity in Arabidopsis by interacting with the host mediator complex. A downy mildew effector attenuates salicylic acid-triggered immunity in Arabidopsis by interacting with the host mediator complex. PLoS biology 2013 imex curation Caillaud MC., Asai S., Rallapalli G., Piquerez S., Fabro G., Jones JD. Only protein-protein interactions nicbe Nicotiana benthamiana anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Caillaud MC., Asai S., Rallapalli G., Piquerez S., Fabro G., Jones JD. DIP original experiment: DIP-256134X PLoS biology 2013 IMEx A downy mildew effector attenuates salicylic acid-triggered immunity in Arabidopsis by interacting with the host mediator complex. A downy mildew effector attenuates salicylic acid-triggered immunity in Arabidopsis by interacting with the host mediator complex. A downy mildew effector attenuates salicylic acid-triggered immunity in Arabidopsis by interacting with the host mediator complex. PLoS biology 2013 imex curation Caillaud MC., Asai S., Rallapalli G., Piquerez S., Fabro G., Jones JD. Only protein-protein interactions nicbe Nicotiana benthamiana bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Caillaud MC., Asai S., Rallapalli G., Piquerez S., Fabro G., Jones JD. DIP original experiment: DIP-256133X PLoS biology 2013 IMEx A downy mildew effector attenuates salicylic acid-triggered immunity in Arabidopsis by interacting with the host mediator complex. g3c9p1_hyaae RxL44 protein protein hyaae Hyaloperonospora arabidopsidis (strain Emoy2) Downy mildew agent Peronospora arabidopsidis AATVAASTHGLEVVPDPVKFSLLQATAETGHQADVDGKINRFLTSKDADLPHLVAPAGYAPSLLQKGGIGRYLRSTGVDDADLEERRGWHKHHKKHKKHKRKHHHHAHESSDSL DIP protein G3C9P1 original sequence version: 4 md19a_arath Mediator of RNA polymerase II transcription subunit 19a MED19_1 MXC9.19 At5g12230 MED19A protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEPERLKFGGPRELCGAADLISQFKLVQHHEFFCKKSLPVSLSDSHYLHNVVGDTEIRKGEGMQLDQLIESISQSRETNIRIQPFDIDELQESFQLNDMTPVELPPAEKGAPTIPSKSKSESKDRDRKHKKHKDRDKDKDREHKKHKHKHKDRSKDKDKDKDRDRKKDKNGHHDSGDHSKKHHDKKRKHDGDEDLNDVQRHKKNKHKSSKLDEVGAIRVAG DIP protein Q9FMP0 original sequence version: 56 177F2531AD9E599B med6_arath Mediator of RNA polymerase II transcription subunit 6 MED6_1 MHC9 At3g21350 MED6 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDSSLLSAATADTFNGNAADQIPPPLQPPGTDMTGISFRDQLWINSYPLDRNYIFDYFALSPFYDTTCNNEILRRRSIHPLDLSHLSKMTGLEYMLTDATEPNLFVFRKQKRDGPEKVTPMLTYYILDGSIYQAPQLCSVFAARVSRTIYNISKAFTDAASKLETIRQDLQVCLVAIVLSLSVNLGSYFLLIFKLMANGEQVYGFNKFLFDTENQNEPAESKPASETVDLKEMKRVDVILTSLYRKLAPPPPPPPFPEGYVSQEALGEKEELGTQGGESQPPQVDPIIDQGPAKRMKF DIP protein F4IXJ7 original sequence version: 22 000D39D2EDD7E4E7 med19a-med6-1 1 6 unspecified role unspecified role prey prey arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 5 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association med19a-rxl44-1 2 4 unspecified role unspecified role prey prey G3C9P1:p.[His92Asn;His93Ala;Lys94Ala;Lys95Ile;His96Arg;Lys97Ser] H92N/H93A/K94A/K95I/H96R/K97S mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain K S certain certain sequence position certain certain certain sequence position certain H R certain certain sequence position certain certain certain sequence position certain K I certain certain sequence position certain certain certain sequence position certain K A certain certain sequence position certain certain certain sequence position certain H A certain certain sequence position certain certain certain sequence position certain H N This feature has been corrected as a result of our quality control procedures. The original label was 'H92N/H93A/K94A/K95I/H96R/K97S'. Wed May 02 14:40:12 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his92asn,his93ala,lys94ala,lys95ile,his96arg,lys97ser' Tue Jun 30 19:47:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[His92Asn;His93Ala;Lys94Ala;Lys95Ile;His96Arg;Lys97Ser]' HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range nicbe Nicotiana benthamiana 5 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range nicbe Nicotiana benthamiana physical association physical association med19a-rxl44-2 3 4 unspecified role unspecified role unspecified role unspecified role nYFP-tag nYFP-tag nyfp nYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range nicbe Nicotiana benthamiana 5 unspecified role unspecified role unspecified role unspecified role cYFP-tag cYFP-tag cyfp cYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range nicbe Nicotiana benthamiana physical association physical association