DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu The bacterial cell division proteins FtsA and FtsZ self-organize into dynamic cytoskeletal patterns. The bacterial cell division proteins FtsA and FtsZ self-organize into dynamic cytoskeletal patterns. Nature cell biology 2014 imex curation Loose M., Mitchison TJ. Only protein-protein interactions in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati weight by comassie molecular weight estimation by coomasie staining weight by comassie Loose M., Mitchison TJ. DIP original experiment: DIP-260066X Nature cell biology 2014 IMEx The bacterial cell division proteins FtsA and FtsZ self-organize into dynamic cytoskeletal patterns. The bacterial cell division proteins FtsA and FtsZ self-organize into dynamic cytoskeletal patterns. The bacterial cell division proteins FtsA and FtsZ self-organize into dynamic cytoskeletal patterns. Nature cell biology 2014 imex curation Loose M., Mitchison TJ. Only protein-protein interactions in vitro In vitro fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Loose M., Mitchison TJ. DIP original experiment: DIP-260069X Nature cell biology 2014 IMEx The bacterial cell division proteins FtsA and FtsZ self-organize into dynamic cytoskeletal patterns. The bacterial cell division proteins FtsA and FtsZ self-organize into dynamic cytoskeletal patterns. The bacterial cell division proteins FtsA and FtsZ self-organize into dynamic cytoskeletal patterns. Nature cell biology 2014 imex curation Loose M., Mitchison TJ. Only protein-protein interactions in vitro In vitro fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Loose M., Mitchison TJ. DIP original experiment: DIP-260070X Nature cell biology 2014 IMEx The bacterial cell division proteins FtsA and FtsZ self-organize into dynamic cytoskeletal patterns. The bacterial cell division proteins FtsA and FtsZ self-organize into dynamic cytoskeletal patterns. The bacterial cell division proteins FtsA and FtsZ self-organize into dynamic cytoskeletal patterns. Nature cell biology 2014 imex curation Loose M., Mitchison TJ. Only protein-protein interactions in vitro In vitro fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Loose M., Mitchison TJ. DIP original experiment: DIP-260068X Nature cell biology 2014 IMEx The bacterial cell division proteins FtsA and FtsZ self-organize into dynamic cytoskeletal patterns. The bacterial cell division proteins FtsA and FtsZ self-organize into dynamic cytoskeletal patterns. The bacterial cell division proteins FtsA and FtsZ self-organize into dynamic cytoskeletal patterns. Nature cell biology 2014 imex curation Loose M., Mitchison TJ. Only protein-protein interactions in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati weight by comassie molecular weight estimation by coomasie staining weight by comassie Loose M., Mitchison TJ. DIP original experiment: DIP-260067X Nature cell biology 2014 IMEx The bacterial cell division proteins FtsA and FtsZ self-organize into dynamic cytoskeletal patterns. zipa_ecoli Cell division protein ZipA zipA FtsZ interacting protein A JW2404 b2412 protein protein ecoli Escherichia coli (strain K12) MMQDLRLILIIVGAIAIIALLVHGFWTSRKERSSMFRDRPLKRMKSKRDDDSYDEDVEDDEGVGEVRVHRVNHAPANAQEHEAARPSPQHQYQPPYASAQPRQPVQQPPEAQVPPQHAPHPAQPVQQPAYQPQPEQPLQQPVSPQVAPAPQPVHSAPQPAQQAFQPAEPVAAPQPEPVAEPAPVMDKPKRKEAVIIMNVAAHHGSELNGELLLNSIQQAGFIFGDMNIYHRHLSPDGSGPALFSLANMVKPGTFDPEMKDFTTPGVTIFMQVPSYGDELQNFKLMLQSAQHIADEVGGVVLDDQRRMMTPQKLREYQDIIREVKDANA DIP protein P77173 original sequence version: 111 A20F119A153A782B ftsa_ecoli Cell division protein FtsA ftsA divA b0094 JW0092 protein protein ecoli Escherichia coli (strain K12) MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF DIP protein P0ABH0 original sequence version: 67 C2475377A229B982 ftsz_ecoli Cell division protein FtsZ ftsZ sfiB sulB b0095 JW0093 protein protein ecoli Escherichia coli (strain K12) MFEPMELTNDAVIKVIGVGGGGGNAVEHMVRERIEGVEFFAVNTDAQALRKTAVGQTIQIGSGITKGLGAGANPEVGRNAADEDRDALRAALEGADMVFIAAGMGGGTGTGAAPVVAEVAKDLGILTVAVVTKPFNFEGKKRMAFAEQGITELSKHVDSLITIPNDKLLKVLGRGISLLDAFGAANDVLKGAVQGIAELITRPGLMNVDFADVRTVMSEMGYAMMGSGVASGEDRAEEAAEMAISSPLLEDIDLSGARGVLVNITAGFDLRLDEFETVGNTIRAFASDNATVVIGTSLDPDMNDELRVTVVATGIGMDKRPEITLVTNKQVQQPVMDRYQQHGMAPLTQEQKPVAKVVNDNAPQTAKEPDYLDIPAFLRKQAD DIP protein P0A9A6 original sequence version: 83 DIP protein P0A9A6 original sequence version: 82 DIP protein P0A9A6 original sequence version: 72 B3A53340367DBBA0 ftsa-ftsz-5 1 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 8 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction ftsz-ftsz-5 2 8 unspecified role unspecified role unspecified role unspecified role Cy5-label Cy5-label cy5 label cy5 label n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 8 unspecified role unspecified role unspecified role unspecified role Alexa488-label Alexa488-label alexa 488 label alexa 488 label n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction ftsz-zipa-2 5 6 unspecified role unspecified role unspecified role unspecified role Region 23-328 Region 23-328 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 8 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction ftsa-ftsz-6 3 7 unspecified role unspecified role unspecified role unspecified role Cy5-label Cy5-label cy5 label cy5 label n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 8 unspecified role unspecified role unspecified role unspecified role Alexa488-label Alexa488-label alexa 488 label alexa 488 label n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction ftsz-2 4 8 unspecified role unspecified role unspecified role unspecified role Alexa488-label Alexa488-label alexa 488 label alexa 488 label n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction