DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Functional assessment of the mutational effects of human IRAK4 and MyD88 genes. Functional assessment of the mutational effects of human IRAK4 and MyD88 genes. Molecular immunology 2014 imex curation Yamamoto T., Tsutsumi N., Tochio H., Ohnishi H., Kubota K., Kato Z., Shirakawa M., Kondo N. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Yamamoto T., Tsutsumi N., Tochio H., Ohnishi H., Kubota K., Kato Z., Shirakawa M., Kondo N. DIP original experiment: DIP-266681X Molecular immunology 2014 IMEx Functional assessment of the mutational effects of human IRAK4 and MyD88 genes. Functional assessment of the mutational effects of human IRAK4 and MyD88 genes. Functional assessment of the mutational effects of human IRAK4 and MyD88 genes. Molecular immunology 2014 imex curation Yamamoto T., Tsutsumi N., Tochio H., Ohnishi H., Kubota K., Kato Z., Shirakawa M., Kondo N. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Yamamoto T., Tsutsumi N., Tochio H., Ohnishi H., Kubota K., Kato Z., Shirakawa M., Kondo N. DIP original experiment: DIP-266683X Molecular immunology 2014 IMEx Functional assessment of the mutational effects of human IRAK4 and MyD88 genes. Functional assessment of the mutational effects of human IRAK4 and MyD88 genes. Functional assessment of the mutational effects of human IRAK4 and MyD88 genes. Molecular immunology 2014 imex curation Yamamoto T., Tsutsumi N., Tochio H., Ohnishi H., Kubota K., Kato Z., Shirakawa M., Kondo N. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Yamamoto T., Tsutsumi N., Tochio H., Ohnishi H., Kubota K., Kato Z., Shirakawa M., Kondo N. DIP original experiment: DIP-266680X Molecular immunology 2014 IMEx Functional assessment of the mutational effects of human IRAK4 and MyD88 genes. Functional assessment of the mutational effects of human IRAK4 and MyD88 genes. Functional assessment of the mutational effects of human IRAK4 and MyD88 genes. Molecular immunology 2014 imex curation Yamamoto T., Tsutsumi N., Tochio H., Ohnishi H., Kubota K., Kato Z., Shirakawa M., Kondo N. Only protein-protein interactions in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Yamamoto T., Tsutsumi N., Tochio H., Ohnishi H., Kubota K., Kato Z., Shirakawa M., Kondo N. DIP original experiment: DIP-266684X Molecular immunology 2014 IMEx Functional assessment of the mutational effects of human IRAK4 and MyD88 genes. Functional assessment of the mutational effects of human IRAK4 and MyD88 genes. Functional assessment of the mutational effects of human IRAK4 and MyD88 genes. Molecular immunology 2014 imex curation Yamamoto T., Tsutsumi N., Tochio H., Ohnishi H., Kubota K., Kato Z., Shirakawa M., Kondo N. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Yamamoto T., Tsutsumi N., Tochio H., Ohnishi H., Kubota K., Kato Z., Shirakawa M., Kondo N. DIP original experiment: DIP-266679X Molecular immunology 2014 IMEx Functional assessment of the mutational effects of human IRAK4 and MyD88 genes. Functional assessment of the mutational effects of human IRAK4 and MyD88 genes. Functional assessment of the mutational effects of human IRAK4 and MyD88 genes. Molecular immunology 2014 imex curation Yamamoto T., Tsutsumi N., Tochio H., Ohnishi H., Kubota K., Kato Z., Shirakawa M., Kondo N. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Yamamoto T., Tsutsumi N., Tochio H., Ohnishi H., Kubota K., Kato Z., Shirakawa M., Kondo N. DIP original experiment: DIP-266682X Molecular immunology 2014 IMEx Functional assessment of the mutational effects of human IRAK4 and MyD88 genes. p58753-2 Toll/interleukin-1 receptor domain-containing adapter protein TIRAP MAL Adaptor protein Wyatt MyD88 adapter-like protein protein protein human Homo sapiens Human MASSTSLPAPGSRPKKPLGKMADWFRQTLLKKPKKRPNSPESTSSDASQPTSQDSPLPPSLSSVTSPSLPPTHASDSGSSRWSKDYDVCVCHSEEDLVAAQDLVSYLEGSTASLRCFLQLRDATPGGAIVSELCQALSSSHCRVLLITPGFLQDPWCKYQMLQALTEAPGAEGCTIPLLSGLSRAAYPPELRFMYYVDGRGPDGGFRQVKEAVMRCKLLQEGEGERDSATVSDLL DIP protein P58753-2 original sequence version: 119 DIP protein P58753-2 original sequence version: 129 383386AA03B70F32 irak4_human Interleukin-1 receptor-associated kinase 4 Renal carcinoma antigen NY-REN-64 IRAK4 protein protein human Homo sapiens Human MNKPITPSTYVRCLNVGLIRKLSDFIDPQEGWKKLAVAIKKPSGDDRYNQFHIRRFEALLQTGKSPTSELLFDWGTTNCTVGDLVDLLIQNEFFAPASLLLPDAVPKTANTLPSKEAITVQQKQMPFCDKDRTLMTPVQNLEQSYMPPDSSSPENKSLEVSDTRFHSFSFYELKNVTNNFDERPISVGGNKMGEGGFGVVYKGYVNNTTVAVKKLAAMVDITTEELKQQFDQEIKVMAKCQHENLVELLGFSSDGDDLCLVYVYMPNGSLLDRLSCLDGTPPLSWHMRCKIAQGAANGINFLHENHHIHRDIKSANILLDEAFTAKISDFGLARASEKFAQTVMTSRIVGTTAYMAPEALRGEITPKSDIYSFGVVLLEIITGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYIDKKMNDADSTSVEAMYSVASQCLHEKKNKRPDIKKVQQLLQEMTAS DIP protein Q9NWZ3 original sequence version: 93 DIP protein Q9NWZ3 original sequence version: 92 DIP protein Q9NWZ3 original sequence version: 144 6C8156ADF25FF81E q99836-1 Myeloid differentiation primary response protein MyD88 MYD88 protein protein human Homo sapiens Human MAAGGPGAGSAAPVSSTSSLPLAALNMRVRRRLSLFLNVRTQVAADWTALAEEMDFEYLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYILKQQQEEAEKPLQVAAVDSSVPRTAELAGITTLDDPLGHMPERFDAFICYCPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKRLIPIKYKAMKKEFPSILRFITVCDYTNPCTKSWFWTRLAKALSLP DIP protein Q99836-1 original sequence version: 100 DIP protein Q99836-1 original sequence version: 128 DIP protein Q99836 original sequence version: 128 DIP protein Q99836-1 original sequence version: 156 myd88-tirap-5 5 7 unspecified role unspecified role prey prey Region 75-235 Region 75-235 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 9 unspecified role unspecified role bait bait Region 148-296 Region 148-296 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q99836-1:p.Arg196Cys R196C mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain R C This feature has been corrected as a result of our quality control procedures. The original label was 'R196C'. Wed May 02 19:04:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg196cys' Tue Jun 30 19:20:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg196Cys' GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction myd88-1 1 9 unspecified role unspecified role unspecified role unspecified role Region 1-152 Region 1-152 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction irak4-myd88-12 4 8 unspecified role unspecified role unspecified role unspecified role Region 1-150 Region 1-150 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q9NWZ3:p.Arg12Cys R12C mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain R C This feature has been corrected as a result of our quality control procedures. The original label was 'R12C'. Wed May 02 15:17:20 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg12cys' Tue Jun 30 18:06:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg12Cys' Q9NWZ3:p.Arg20Trp R20W mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain R W This feature has been corrected as a result of our quality control procedures. The original label was 'R20W'. Wed May 02 17:51:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg20trp' Tue Jun 30 15:58:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg20Trp' ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role Region 1-152 Region 1-152 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction irak4-myd88-13 3 8 unspecified role unspecified role unspecified role unspecified role Region 1-150 Region 1-150 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q9NWZ3:p.Arg12Cys R12C mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain R C This feature has been corrected as a result of our quality control procedures. The original label was 'R12C'. Wed May 02 17:44:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg12cys' Tue Jun 30 16:45:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg12Cys' Q9NWZ3:p.Arg20Trp R20W mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain R W This feature has been corrected as a result of our quality control procedures. The original label was 'R20W'. Wed May 02 14:49:35 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg20trp' Tue Jun 30 17:28:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg20Trp' ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role Region 1-152 Region 1-152 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction irak4-1 6 8 unspecified role unspecified role unspecified role unspecified role Region 1-150 Region 1-150 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction irak4-myd88-14 2 8 unspecified role unspecified role unspecified role unspecified role Region 1-150 Region 1-150 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role Region 1-152 Region 1-152 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q99836-1:p.Arg98Cys R98C mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain R C This feature has been corrected as a result of our quality control procedures. The original label was 'R98C'. Wed May 02 15:00:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg98cys' Tue Jun 30 16:44:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg98Cys' ecolx Escherichia coli direct interaction direct interaction