IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Homo-oligomerization of the activating natural killer cell receptor NKp30 ectodomain increases its binding affinity for cellular ligands. Homo-oligomerization of the activating natural killer cell receptor NKp30 ectodomain increases its binding affinity for cellular ligands. The Journal of biological chemistry 2014 imex curation Herrmann J., Berberich H., Hartmann J., Beyer S., Davies K., Koch J. I assume "decorating" cells means adding something to them "in vitro" pmid:27754869 memmer-2016 and pmid:22807449-Hartmann 2012 and pmid:24275655 Herrmann 2014 are all in the same group. joachim.koch@gsh.uni-frankfurt.de 05-Sep-2017: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro facs fluorescence-activated cell sorting FACS Flow cytometry facs antibody detection identification by antibody antibody detection Herrmann J., Berberich H., Hartmann J., Beyer S., Davies K., Koch J. I assume "decorating" cells means adding something to them "in vitro" pmid:27754869 memmer-2016 and pmid:22807449-Hartmann 2012 and pmid:24275655 Herrmann 2014 are all in the same group. joachim.koch@gsh.uni-frankfurt.de joachim.koch@gsh.uni-frankfurt.de. Accepted 2017-AUG-04 AT 09:09 BST AT 09:09 BST by ORCHARD The Journal of biological chemistry 2014 imex curation Homo-oligomerization of the activating natural killer cell receptor NKp30 ectodomain increases its binding affinity for cellular ligands. Homo-oligomerization of the activating natural killer cell receptor NKp30 ectodomain increases its binding affinity for cellular ligands. The Journal of biological chemistry 2014 imex curation Herrmann J., Berberich H., Hartmann J., Beyer S., Davies K., Koch J. I assume "decorating" cells means adding something to them "in vitro" pmid:27754869 memmer-2016 and pmid:22807449-Hartmann 2012 and pmid:24275655 Herrmann 2014 are all in the same group. joachim.koch@gsh.uni-frankfurt.de 05-Sep-2017: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection Herrmann J., Berberich H., Hartmann J., Beyer S., Davies K., Koch J. I assume "decorating" cells means adding something to them "in vitro" pmid:27754869 memmer-2016 and pmid:22807449-Hartmann 2012 and pmid:24275655 Herrmann 2014 are all in the same group. joachim.koch@gsh.uni-frankfurt.de joachim.koch@gsh.uni-frankfurt.de. Accepted 2017-AUG-04 AT 09:09 BST AT 09:09 BST by ORCHARD The Journal of biological chemistry 2014 imex curation Homo-oligomerization of the activating natural killer cell receptor NKp30 ectodomain increases its binding affinity for cellular ligands. Homo-oligomerization of the activating natural killer cell receptor NKp30 ectodomain increases its binding affinity for cellular ligands. The Journal of biological chemistry 2014 imex curation Herrmann J., Berberich H., Hartmann J., Beyer S., Davies K., Koch J. I assume "decorating" cells means adding something to them "in vitro" pmid:27754869 memmer-2016 and pmid:22807449-Hartmann 2012 and pmid:24275655 Herrmann 2014 are all in the same group. joachim.koch@gsh.uni-frankfurt.de 05-Sep-2017: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Herrmann J., Berberich H., Hartmann J., Beyer S., Davies K., Koch J. I assume "decorating" cells means adding something to them "in vitro" pmid:27754869 memmer-2016 and pmid:22807449-Hartmann 2012 and pmid:24275655 Herrmann 2014 are all in the same group. joachim.koch@gsh.uni-frankfurt.de joachim.koch@gsh.uni-frankfurt.de. Accepted 2017-AUG-04 AT 09:09 BST AT 09:09 BST by ORCHARD The Journal of biological chemistry 2014 imex curation Homo-oligomerization of the activating natural killer cell receptor NKp30 ectodomain increases its binding affinity for cellular ligands. Homo-oligomerization of the activating natural killer cell receptor NKp30 ectodomain increases its binding affinity for cellular ligands. The Journal of biological chemistry 2014 imex curation Herrmann J., Berberich H., Hartmann J., Beyer S., Davies K., Koch J. I assume "decorating" cells means adding something to them "in vitro" pmid:27754869 memmer-2016 and pmid:22807449-Hartmann 2012 and pmid:24275655 Herrmann 2014 are all in the same group. joachim.koch@gsh.uni-frankfurt.de 05-Sep-2017: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Herrmann J., Berberich H., Hartmann J., Beyer S., Davies K., Koch J. I assume "decorating" cells means adding something to them "in vitro" pmid:27754869 memmer-2016 and pmid:22807449-Hartmann 2012 and pmid:24275655 Herrmann 2014 are all in the same group. joachim.koch@gsh.uni-frankfurt.de joachim.koch@gsh.uni-frankfurt.de. Accepted 2017-AUG-04 AT 09:09 BST AT 09:09 BST by ORCHARD The Journal of biological chemistry 2014 imex curation Homo-oligomerization of the activating natural killer cell receptor NKp30 ectodomain increases its binding affinity for cellular ligands. Homo-oligomerization of the activating natural killer cell receptor NKp30 ectodomain increases its binding affinity for cellular ligands. The Journal of biological chemistry 2014 imex curation Herrmann J., Berberich H., Hartmann J., Beyer S., Davies K., Koch J. I assume "decorating" cells means adding something to them "in vitro" pmid:27754869 memmer-2016 and pmid:22807449-Hartmann 2012 and pmid:24275655 Herrmann 2014 are all in the same group. joachim.koch@gsh.uni-frankfurt.de 05-Sep-2017: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro electron microscopy electron microscopy Electron crystallography Electron cryomicroscopy Electron crystallography Electron cryomicroscopy predetermined predetermined participant predetermined Herrmann J., Berberich H., Hartmann J., Beyer S., Davies K., Koch J. I assume "decorating" cells means adding something to them "in vitro" pmid:27754869 memmer-2016 and pmid:22807449-Hartmann 2012 and pmid:24275655 Herrmann 2014 are all in the same group. joachim.koch@gsh.uni-frankfurt.de joachim.koch@gsh.uni-frankfurt.de. Accepted 2017-AUG-04 AT 09:09 BST AT 09:09 BST by ORCHARD The Journal of biological chemistry 2014 imex curation nr3l1_human Natural cytotoxicity triggering receptor 3 ligand 1 NCR3LG1 B7 homolog 6 B7H6 protein protein human Homo sapiens Human MTWRAAASTCAALLILLWALTTEGDLKVEMMAGGTQITPLNDNVTIFCNIFYSQPLNITSMGITWFWKSLTFDKEVKVFEFFGDHQEAFRPGAIVSPWRLKSGDASLRLPGIQLEEAGEYRCEVVVTPLKAQGTVQLEVVASPASRLLLDQVGMKENEDKYMCESSGFYPEAINITWEKQTQKFPHPIEISEDVITGPTIKNMDGTFNVTSCLKLNSSQEDPGTVYQCVVRHASLHTPLRSNFTLTAARHSLSETEKTDNFSIHWWPISFIGVGLVLLIVLIPWKKICNKSSSAYTPLKCILKHWNSFDTQTLKKEHLIFFCTRAWPSYQLQDGEAWPPEGSVNINTIQQLDVFCRQEGKWSEVPYVQAFFALRDNPDLCQCCRIDPALLTVTSGKSIDDNSTKSEKQTPREHSDAVPDAPILPVSPIWEPPPATTSTTPVLSSQPPTLLLPLQ DIP protein Q68D85 original sequence version: 74 433CE0B0EE0A4470 nctr3_human Natural cytotoxicity triggering receptor 3 NCR3 1C7 LY117 Activating natural killer receptor p30 Natural killer cell p30-related protein protein protein human Homo sapiens Human MAWMLLLILIMVHPGSCALWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLGAGTVLLLRAGFYAVSFLSVAVGSTVYYQGKCLTWKGPRRQLPAVVPAPLPPPCGSSAHLLPPVPGG DIP protein O14931 original sequence version: 110 2855AE4D6902D429 ncr3-ncr3lg1-5 3 7 unspecified role unspecified role neutral component neutral component lbd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range gp67_secretion_sequence tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 6 tag fluorescence tag visualisation by fluorescence tag fluorescence immunocytochemistry immunocytochemistry unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined mouse-ba_f3 Mouse pro B cells IL-3 dependent mouse-baf3 EBI-6922762 ba_f3 Mouse pro B cells IL-3 dependent BA/F3 baf3 colocalization colocalization 3A Binding of soluble 30Stalk-His protein to plasma membrane B7-H6 was significantly stronger than that of 30LBD-His protein. ncr3-ncr3lg1-6 1 7 unspecified role unspecified role neutral component neutral component stalk sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range gp67_secretion_sequence tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 6 tag fluorescence tag visualisation by fluorescence tag fluorescence antibody detection identification by antibody antibody detection unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined mouse-ba_f3 Mouse pro B cells IL-3 dependent mouse-baf3 EBI-6922762 ba_f3 Mouse pro B cells IL-3 dependent BA/F3 baf3 physical association physical association 3 B/C Use of 30Stalk-His protein led to much higher signal intensities than for 30LBD-His protein. ncr3-ncr3lg1-7 2 7 unspecified role unspecified role prey prey stalk sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range gp67_secretion_sequence tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 6 tag fluorescence tag visualisation by fluorescence tag fluorescence antibody detection identification by antibody antibody detection unspecified role unspecified role bait bait c_terminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. direct interaction direct interaction 3 F-H, 4 E/F All of the oligomeric species (monomers, dimers, and oligomers) of soluble NKp30 bound to B7-H6-Ig. Binding of 30Stalk-His proteins was stronger than that of 30LBD-His proteins, and oligomers of the Stalk protein have a higher affinity than dimeric or monomeric forms;however, the observed differences in Kd and Bmax values are small. To determine the apparent ligand binding affinities of the soluble 30Stalk-His and 30LBD-His proteins, we performed ELISA assays with recombinant B7-H6-Ig fusion protein. ncr3lg1-ncr3-1 4 7 unspecified role unspecified role neutral component neutral component lbd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range gp67_secretion_sequence tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 7 unspecified role unspecified role neutral component neutral component lbd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range gp67_secretion_sequence tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 35 31 direct interaction direct interaction 4 A/B ncr3-1 4 7 unspecified role unspecified role neutral component neutral component stalk sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range gp67_secretion_sequence tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 7 unspecified role unspecified role neutral component neutral component stalk sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range gp67_secretion_sequence tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 44 40 physical association physical association 4 A/B the relative content of oligomers was much higher for the 30Stalk-His when compared with the 30LBD-His proteins. ncr3-8 4 7 unspecified role unspecified role neutral component neutral component lbd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range gp67_secretion_sequence tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 7 unspecified role unspecified role neutral component neutral component lbd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range gp67_secretion_sequence tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 49 53 physical association physical association 4 A/Bi ncr3lg1-ncr3-2 2 7 unspecified role unspecified role prey prey lbd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range gp67_secretion_sequence tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 6 tag fluorescence tag visualisation by fluorescence tag fluorescence antibody detection identification by antibody antibody detection unspecified role unspecified role bait bait c_terminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. direct interaction direct interaction 3 F-H, 4 E/F All of the oligomeric species (monomers, dimers, and oligomers) of soluble NKp30 bound to B7-H6-Ig. Binding of 30Stalk-His proteins was stronger than that of 30LBD-His proteins, and oligomers of the Stalk protein have a higher affinity than dimeric or monomeric forms;however, the observed differences in Kd and Bmax values are small. ncr3-ncr3-1 5 7 unspecified role unspecified role neutral component neutral component stalk sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range gp67_secretion_sequence tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 7 unspecified role unspecified role neutral component neutral component stalk sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range gp67_secretion_sequence tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. direct interaction direct interaction 5 ncr3-ncr3-2 5 7 unspecified role unspecified role neutral component neutral component lbd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range gp67_secretion_sequence tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 7 unspecified role unspecified role neutral component neutral component lbd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range gp67_secretion_sequence tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. direct interaction direct interaction 5 ncr3-ncr3-4 4 7 unspecified role unspecified role neutral component neutral component stalk sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range gp67_secretion_sequence tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 7 unspecified role unspecified role neutral component neutral component stalk sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range gp67_secretion_sequence tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. physical association physical association 4 A