DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Role of autophagy in glycogen breakdown and its relevance to chloroquine myopathy. Role of autophagy in glycogen breakdown and its relevance to chloroquine myopathy. PLoS biology 2013 imex curation Zirin J., Nieuwenhuis J., Perrimon N. Only protein-protein interactions drome Drosophila melanogaster (Fruit fly) Fruit fly anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zirin J., Nieuwenhuis J., Perrimon N. DIP original experiment: DIP-256120X PLoS biology 2013 IMEx Role of autophagy in glycogen breakdown and its relevance to chloroquine myopathy. q9vfc8-2 Glycogen [starch] synthase GlyS Glycogen synthase CG6904 C protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MNRRFSRVESGADLKDYFDRGDIASRENRWNFEVAWEVANKVGGIYTVIRSKAYVSTEEMGEQLCMMGPYKEHCARTEMEEMEFPRGNPLLDAVNSLRSRGYKIHTGRWLVDGNPQLILFDIGSAAWKLDQFKSEMWEKCHIGIPHLDIETNDAIILGFMIAEFLEEFRNFAVTYSQNNELSAPRIVAHFHEWQAGVGLIVLRTRLVEIATVFTTHATLLGRYLCAGNTDFYNNLDKFAVDEEAGKRQIYHRYCLERGATHLAHVFTTVSEITGYEAEHLLKRKPDIITPNGLNVKKFSAIHEFQNLHAVAKEKINEFVRGHFYGHIDFDLDKTLYFFIAGRYEFGNKGADIFIEALARLNAMLKHEKPDTTVVAFLIFPTKTNNFNVDSLRGHAVIKQLRDTINNVQQAVGKRMFDTCLQGNIPNADDLLQKDDLVKIKRCMFAMQRDSMPPVTTHNVADDWNDPVLSSIRRCHLFNSRHDRVKMVFHPEFLTSTNPLFGIDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEEHISDPKSYGIYIVDRRYIGLENSVQQLSSFMMEFSRLNRRQRIIQRNRTERLSDLLDWRTLGIYYRQARVKALQAVYPDYVDELSLYGSKNNLIFSRPHSEPPSPTSSRHTTPAPSVHGSDDEDSVDEETELKELGIK DIP protein Q9VFC8-2 original sequence version: 97 No experimental confirmation available. q9w2s2_drome Atg-8a Atg8alpha Atg8a CG1534 ATG8 ATG8a Atg8 Atg8A BcDNA:LD05816 DmAtg8a Dmel\CG32672 DrAtg8a LC3 atg8 atg8A atg8a dAtg8a CG32672 Dmel_CG32672 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MKFQYKEEHAFEKRRAEGDKIRRKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHEEDYFLYIAYSDENVYGMAKIN DIP protein Q9W2S2 original sequence version: 98 DIP protein Q9W2S2 original sequence version: 119 2B99947562A320A1 glys-atg8a-1 1 3 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range drome Drosophila melanogaster (Fruit fly) Fruit fly 2 unspecified role unspecified role bait bait Q9VFC8-2:p.Trp609Ala W609A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain W A This feature has been corrected as a result of our quality control procedures. The original label was 'W609A'. Wed May 02 17:21:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp609ala' Tue Jun 30 19:53:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp609Ala' Q9VFC8-2:p.Arg593Ala R593A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R593A'. Wed May 02 18:03:12 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg593ala' Tue Jun 30 15:49:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg593Ala' Venus-tag Venus-tag venus venus fluorescent protein tag venus undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined drome Drosophila melanogaster (Fruit fly) Fruit fly physical association physical association