DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Antibacterial membrane attack by a pore-forming intestinal C-type lectin. Antibacterial membrane attack by a pore-forming intestinal C-type lectin. Nature 2014 imex curation Mukherjee S., Zheng H., Derebe MG., Callenberg KM., Partch CL., Rollins D., Propheter DC., Rizo J., Grabe M., Jiang QX., Hooper LV. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Mukherjee S., Zheng H., Derebe MG., Callenberg KM., Partch CL., Rollins D., Propheter DC., Rizo J., Grabe M., Jiang QX., Hooper LV. DIP original experiment: DIP-259820X Nature 2014 IMEx Antibacterial membrane attack by a pore-forming intestinal C-type lectin. Antibacterial membrane attack by a pore-forming intestinal C-type lectin. Antibacterial membrane attack by a pore-forming intestinal C-type lectin. Nature 2014 imex curation Mukherjee S., Zheng H., Derebe MG., Callenberg KM., Partch CL., Rollins D., Propheter DC., Rizo J., Grabe M., Jiang QX., Hooper LV. Only protein-protein interactions in vitro In vitro 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Mukherjee S., Zheng H., Derebe MG., Callenberg KM., Partch CL., Rollins D., Propheter DC., Rizo J., Grabe M., Jiang QX., Hooper LV. DIP original experiment: DIP-259819X Nature 2014 IMEx Antibacterial membrane attack by a pore-forming intestinal C-type lectin. reg3a_human Regenerating islet-derived protein 3-alpha REG3A HIP Hepatointestinal pancreatic protein Human proislet peptide PAP PAP1 Pancreatitis-associated protein 1 Regenerating islet-derived protein III-alpha protein protein human Homo sapiens Human MLPPMALPSVSWMLLSCLMLLSQVQGEEPQRELPSARIRCPKGSKAYGSHCYALFLSPKSWTDADLACQKRPSGNLVSVLSGAEGSFVSSLVKSIGNSYSYVWIGLHDPTQGTEPNGEGWEWSSSDVMNYFAWERNPSTISSPGHCASLSRSTAFLRWKDYNCNVRLPYVCKFTD DIP protein Q06141 original sequence version: 127 C51149FAC22EB68C reg3a-1 2 3 unspecified role unspecified role unspecified role unspecified role Region 38-175 Region 38-175 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction reg3a-2 1 3 unspecified role unspecified role unspecified role unspecified role Region 38-175 Region 38-175 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction