DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structure of UreG/UreF/UreH complex reveals how urease accessory proteins facilitate maturation of Helicobacter pylori urease. Structure of UreG/UreF/UreH complex reveals how urease accessory proteins facilitate maturation of Helicobacter pylori urease. PLoS biology 2013 imex curation Fong YH., Wong HC., Yuen MH., Lau PH., Chen YW., Wong KB. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Fong YH., Wong HC., Yuen MH., Lau PH., Chen YW., Wong KB. DIP original experiment: DIP-256090X PLoS biology 2013 IMEx Structure of UreG/UreF/UreH complex reveals how urease accessory proteins facilitate maturation of Helicobacter pylori urease. Structure of UreG/UreF/UreH complex reveals how urease accessory proteins facilitate maturation of Helicobacter pylori urease. Structure of UreG/UreF/UreH complex reveals how urease accessory proteins facilitate maturation of Helicobacter pylori urease. PLoS biology 2013 imex curation Fong YH., Wong HC., Yuen MH., Lau PH., Chen YW., Wong KB. Only protein-protein interactions ecolx Escherichia coli sls static light scattering sls predetermined predetermined participant predetermined Fong YH., Wong HC., Yuen MH., Lau PH., Chen YW., Wong KB. DIP original experiment: DIP-256093X PLoS biology 2013 IMEx Structure of UreG/UreF/UreH complex reveals how urease accessory proteins facilitate maturation of Helicobacter pylori urease. Structure of UreG/UreF/UreH complex reveals how urease accessory proteins facilitate maturation of Helicobacter pylori urease. Structure of UreG/UreF/UreH complex reveals how urease accessory proteins facilitate maturation of Helicobacter pylori urease. PLoS biology 2013 imex curation Fong YH., Wong HC., Yuen MH., Lau PH., Chen YW., Wong KB. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Fong YH., Wong HC., Yuen MH., Lau PH., Chen YW., Wong KB. DIP original experiment: DIP-256098X PLoS biology 2013 IMEx Structure of UreG/UreF/UreH complex reveals how urease accessory proteins facilitate maturation of Helicobacter pylori urease. Structure of UreG/UreF/UreH complex reveals how urease accessory proteins facilitate maturation of Helicobacter pylori urease. Structure of UreG/UreF/UreH complex reveals how urease accessory proteins facilitate maturation of Helicobacter pylori urease. PLoS biology 2013 imex curation Fong YH., Wong HC., Yuen MH., Lau PH., Chen YW., Wong KB. Only protein-protein interactions ecolx Escherichia coli pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Fong YH., Wong HC., Yuen MH., Lau PH., Chen YW., Wong KB. DIP original experiment: DIP-256094X PLoS biology 2013 IMEx Structure of UreG/UreF/UreH complex reveals how urease accessory proteins facilitate maturation of Helicobacter pylori urease. Structure of UreG/UreF/UreH complex reveals how urease accessory proteins facilitate maturation of Helicobacter pylori urease. Structure of UreG/UreF/UreH complex reveals how urease accessory proteins facilitate maturation of Helicobacter pylori urease. PLoS biology 2013 imex curation Fong YH., Wong HC., Yuen MH., Lau PH., Chen YW., Wong KB. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Fong YH., Wong HC., Yuen MH., Lau PH., Chen YW., Wong KB. DIP original experiment: DIP-256097X PLoS biology 2013 IMEx Structure of UreG/UreF/UreH complex reveals how urease accessory proteins facilitate maturation of Helicobacter pylori urease. Structure of UreG/UreF/UreH complex reveals how urease accessory proteins facilitate maturation of Helicobacter pylori urease. Structure of UreG/UreF/UreH complex reveals how urease accessory proteins facilitate maturation of Helicobacter pylori urease. PLoS biology 2013 imex curation Fong YH., Wong HC., Yuen MH., Lau PH., Chen YW., Wong KB. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Fong YH., Wong HC., Yuen MH., Lau PH., Chen YW., Wong KB. DIP original experiment: DIP-256089X PLoS biology 2013 IMEx Structure of UreG/UreF/UreH complex reveals how urease accessory proteins facilitate maturation of Helicobacter pylori urease. Structure of UreG/UreF/UreH complex reveals how urease accessory proteins facilitate maturation of Helicobacter pylori urease. Structure of UreG/UreF/UreH complex reveals how urease accessory proteins facilitate maturation of Helicobacter pylori urease. PLoS biology 2013 imex curation Fong YH., Wong HC., Yuen MH., Lau PH., Chen YW., Wong KB. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Fong YH., Wong HC., Yuen MH., Lau PH., Chen YW., Wong KB. DIP original experiment: DIP-256099X PLoS biology 2013 IMEx Structure of UreG/UreF/UreH complex reveals how urease accessory proteins facilitate maturation of Helicobacter pylori urease. Structure of UreG/UreF/UreH complex reveals how urease accessory proteins facilitate maturation of Helicobacter pylori urease. Structure of UreG/UreF/UreH complex reveals how urease accessory proteins facilitate maturation of Helicobacter pylori urease. PLoS biology 2013 imex curation Fong YH., Wong HC., Yuen MH., Lau PH., Chen YW., Wong KB. Only protein-protein interactions in vitro In vitro sls static light scattering sls predetermined predetermined participant predetermined Fong YH., Wong HC., Yuen MH., Lau PH., Chen YW., Wong KB. DIP original experiment: DIP-256091X PLoS biology 2013 IMEx Structure of UreG/UreF/UreH complex reveals how urease accessory proteins facilitate maturation of Helicobacter pylori urease. Structure of UreG/UreF/UreH complex reveals how urease accessory proteins facilitate maturation of Helicobacter pylori urease. Structure of UreG/UreF/UreH complex reveals how urease accessory proteins facilitate maturation of Helicobacter pylori urease. PLoS biology 2013 imex curation Fong YH., Wong HC., Yuen MH., Lau PH., Chen YW., Wong KB. Only protein-protein interactions in vitro In vitro sls static light scattering sls predetermined predetermined participant predetermined Fong YH., Wong HC., Yuen MH., Lau PH., Chen YW., Wong KB. DIP original experiment: DIP-256096X PLoS biology 2013 IMEx Structure of UreG/UreF/UreH complex reveals how urease accessory proteins facilitate maturation of Helicobacter pylori urease. Structure of UreG/UreF/UreH complex reveals how urease accessory proteins facilitate maturation of Helicobacter pylori urease. Structure of UreG/UreF/UreH complex reveals how urease accessory proteins facilitate maturation of Helicobacter pylori urease. PLoS biology 2013 imex curation Fong YH., Wong HC., Yuen MH., Lau PH., Chen YW., Wong KB. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Fong YH., Wong HC., Yuen MH., Lau PH., Chen YW., Wong KB. DIP original experiment: DIP-256092X PLoS biology 2013 IMEx Structure of UreG/UreF/UreH complex reveals how urease accessory proteins facilitate maturation of Helicobacter pylori urease. Structure of UreG/UreF/UreH complex reveals how urease accessory proteins facilitate maturation of Helicobacter pylori urease. Structure of UreG/UreF/UreH complex reveals how urease accessory proteins facilitate maturation of Helicobacter pylori urease. PLoS biology 2013 imex curation Fong YH., Wong HC., Yuen MH., Lau PH., Chen YW., Wong KB. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Fong YH., Wong HC., Yuen MH., Lau PH., Chen YW., Wong KB. DIP original experiment: DIP-256100X PLoS biology 2013 IMEx Structure of UreG/UreF/UreH complex reveals how urease accessory proteins facilitate maturation of Helicobacter pylori urease. Structure of UreG/UreF/UreH complex reveals how urease accessory proteins facilitate maturation of Helicobacter pylori urease. Structure of UreG/UreF/UreH complex reveals how urease accessory proteins facilitate maturation of Helicobacter pylori urease. PLoS biology 2013 imex curation Fong YH., Wong HC., Yuen MH., Lau PH., Chen YW., Wong KB. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Fong YH., Wong HC., Yuen MH., Lau PH., Chen YW., Wong KB. DIP original experiment: DIP-256095X PLoS biology 2013 IMEx Structure of UreG/UreF/UreH complex reveals how urease accessory proteins facilitate maturation of Helicobacter pylori urease. ure23_helpy Urease subunit alpha ureA hpuA HP_0073 Urea amidohydrolase subunit alpha protein protein helpy Helicobacter pylori Campylobacter pylori MKLTPKELDKLMLHYAGELAKKRKEKGIKLNYVEAVALISAHIMEEARAGKKTAAELMQEGRTLLKPDDVMDGVASMIHEVGIEAMFPDGTKLVTVHTPIEANGKLVPGELFLKNEDITINEGKKAVSVKVKNVGDRPVQIGSHFHFFEVNRCLDFDREKTFGKRLDIASGTAVRFEPGEEKSVELIDIGGNRRIFGFNALVDRQADNESKKIALHRAKERGFHGAKSDDNYVKTIKE DIP protein P14916 original sequence version: 118 mint Ammonia produced by ureolysis increases the gastric pH thereby providing an environment permissive for colonization of the stomach 4E77328669CD9A2D ure1_helpy Urease subunit beta ureB hpuB HP_0072 Urea amidohydrolase subunit beta protein protein helpy Helicobacter pylori Campylobacter pylori MKKISRKEYVSMYGPTTGDKVRLGDTDLIAEVEHDYTIYGEELKFGGGKTLREGMSQSNNPSKEELDLIITNALIVDYTGIYKADIGIKDGKIAGIGKGGNKDMQDGVKNNLSVGPATEALAGEGLIVTAGGIDTHIHFISPQQIPTAFASGVTTMIGGGTGPADGTNATTITPGRRNLKWMLRAAEEYSMNLGFLAKGNASNDASLADQIEAGAIGFKIHEDWGTTPSAINHALDVADKYDVQVAIHTDTLNEAGCVEDTMAAIAGRTMHTFHTEGAGGGHAPDIIKVAGEHNILPASTNPTIPFTVNTEAEHMDMLMVCHHLDKSIKEDVQFADSRIRPQTIAAEDTLHDMGIFSITSSDSQAMGRVGEVITRTWQTADKNKKEFGRLKEEKGDNDNFRIKRYLSKYTINPAIAHGISEYVGSVEVGKVADLVLWSPAFFGVKPNMIIKGGFIALSQMGDANASIPTPQPVYYREMFAHHGKAKYDANITFVSQAAYDKGIKEELGLERQVLPVKNCRNITKKDMQFNDTTAHIEVNPETYHVFVDGKEVTSKPANKVSLAQLFSIF DIP protein P69996 original sequence version: 73 mint Ammonia produced by ureolysis increases the gastric pH thereby providing an environment permissive for colonization of the stomach 4C8A6BC6C8295584 uref_helpy Urease accessory protein UreF HP_0069 ureF protein protein helpy Helicobacter pylori Campylobacter pylori MDKGKSVKSTEKSVGMPPKTPKTDNNAHVDNEFLILQVNDAVFPIGSYTHSFGLETYIQQKKVTNKESALEYLKANLSSQFLYTEMLSLKLTYESALQQDLKKILGVEEVIMLSTSPMELRLANQKLGNRFIKTLQAMNELDMGEFFNAYAQKTKDPTHATSYGVFAASLGIELKKALRHYLYAQTSNMVINCVKSVPLSQNDGQKILLSLQSPFNQLIEKTLELDESHLCTASVQNDIKAMQHESLYSRLYMS DIP protein Q09065 original sequence version: 82 Probably facilitates nickel incorporation mint 6209F547A96FE028 ureh_helpy Urease accessory protein UreH HP_0067 ureH protein protein helpy Helicobacter pylori Campylobacter pylori MNTYAQESKLRLKTKIGADGRCVIEDNFFTPPFKLMAPFYPKDDLAEIMLLAVSPGMMRGDAQDVQLNIGPNCKLRITSQSFEKIHNTEDGFASRDMHIVVGENAFLDFAPFPLIPFENAHFKGNTTISLRSSSQLLYSEIIVAGRVARNELFKFNRLHTKISILQDEKPIYYDNTILDPKTTDLNNMCMFDGYTHYLNLVLVNCPIELSGVRECIEESEGVDGAVSETASSHLCVKALAKGSEPLLHLREKIARLVTQTTTQKV DIP protein Q09067 original sequence version: 74 mint Probably facilitates nickel incorporation 8F16568C7DF9B162 ureg_helpy Urease accessory protein UreG ureG HP_0068 protein protein helpy Helicobacter pylori Campylobacter pylori MVKIGVCGPVGSGKTALIEALTRHMSKDYDMAVITNDIYTKEDAEFMCKNSVMPRERIIGVETGGCPHTAIREDASMNLEAVEEMHGRFPNLELLLIESGGDNLSATFNPELADFTIFVIDVAEGDKIPRKGGPGITRSDLLVINKIDLAPYVGADLKVMERDSKKMRGEKPFIFTNIRAKEGLDDVIAWIKRNALLED DIP protein Q09066 original sequence version: 86 Probably facilitates nickel incorporation mint A23E448EB6A208B1 uref-ureg-1 8 17 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 16 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 15 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association uref-ureg-2 6 17 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 16 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 15 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association ureg-1 9 17 unspecified role unspecified role unspecified role unspecified role Q09066:p.Cys66Ala C66A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain C A This feature has been corrected as a result of our quality control procedures. The original label was 'C66A'. Wed May 02 17:22:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys66ala' Tue Jun 30 17:45:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys66Ala' Q09066:p.His68Ala H68A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain H A This feature has been corrected as a result of our quality control procedures. The original label was 'H68A'. Wed May 02 19:53:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his68ala' Tue Jun 30 16:22:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His68Ala' ecolx Escherichia coli direct interaction direct interaction urea-ureb-13 11 14 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 13 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction uref-ureg-3 3 17 unspecified role unspecified role prey prey ecolx Escherichia coli 15 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q09065:p.[Arg179Ala;Tyr183Asp] R179A/Y183D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain Y D certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R179A/Y183D'. Wed May 02 18:19:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg179ala,tyr183asp' Tue Jun 30 18:20:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg179Ala;Tyr183Asp]' ecolx Escherichia coli physical association physical association uref-ureh-1 4 16 unspecified role unspecified role prey prey ecolx Escherichia coli 15 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction uref-ureh-3 10 16 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 15 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction uref-ureg-4 1 17 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 16 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 15 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association uref-ureg-5 5 17 unspecified role unspecified role prey prey ecolx Escherichia coli 16 unspecified role unspecified role prey prey ecolx Escherichia coli 15 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli association association uref-urea-1 7 14 unspecified role unspecified role prey prey ecolx Escherichia coli 13 unspecified role unspecified role prey prey ecolx Escherichia coli 17 unspecified role unspecified role prey prey ecolx Escherichia coli 16 unspecified role unspecified role prey prey ecolx Escherichia coli 15 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli association association uref-ureh-4 2 16 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 15 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction ureg-2 12 17 unspecified role unspecified role unspecified role unspecified role Q09066:p.Cys66Ala C66A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain C A This feature has been corrected as a result of our quality control procedures. The original label was 'C66A'. Wed May 02 17:40:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys66ala' Tue Jun 30 16:23:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys66Ala' Q09066:p.His68Ala H68A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain H A This feature has been corrected as a result of our quality control procedures. The original label was 'H68A'. Wed May 02 15:47:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his68ala' Tue Jun 30 16:35:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His68Ala' ecolx Escherichia coli direct interaction direct interaction