DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Regulation of temperature-responsive flowering by MADS-box transcription factor repressors. Regulation of temperature-responsive flowering by MADS-box transcription factor repressors. Science (New York, N.Y.) 2013 imex curation Lee JH., Ryu HS., Chung KS., Posé D., Kim S., Schmid M., Ahn JH. Only protein-protein interactions allce Allium cepa (Onion) Onion bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Lee JH., Ryu HS., Chung KS., Posé D., Kim S., Schmid M., Ahn JH. DIP original experiment: DIP-265006X Science (New York, N.Y.) 2013 IMEx Regulation of temperature-responsive flowering by MADS-box transcription factor repressors. Regulation of temperature-responsive flowering by MADS-box transcription factor repressors. Regulation of temperature-responsive flowering by MADS-box transcription factor repressors. Science (New York, N.Y.) 2013 imex curation Lee JH., Ryu HS., Chung KS., Posé D., Kim S., Schmid M., Ahn JH. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Lee JH., Ryu HS., Chung KS., Posé D., Kim S., Schmid M., Ahn JH. DIP original experiment: DIP-264998X Science (New York, N.Y.) 2013 IMEx Regulation of temperature-responsive flowering by MADS-box transcription factor repressors. Regulation of temperature-responsive flowering by MADS-box transcription factor repressors. Regulation of temperature-responsive flowering by MADS-box transcription factor repressors. Science (New York, N.Y.) 2013 imex curation Lee JH., Ryu HS., Chung KS., Posé D., Kim S., Schmid M., Ahn JH. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Lee JH., Ryu HS., Chung KS., Posé D., Kim S., Schmid M., Ahn JH. DIP original experiment: DIP-265003X Science (New York, N.Y.) 2013 IMEx Regulation of temperature-responsive flowering by MADS-box transcription factor repressors. Regulation of temperature-responsive flowering by MADS-box transcription factor repressors. Regulation of temperature-responsive flowering by MADS-box transcription factor repressors. Science (New York, N.Y.) 2013 imex curation Lee JH., Ryu HS., Chung KS., Posé D., Kim S., Schmid M., Ahn JH. Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Lee JH., Ryu HS., Chung KS., Posé D., Kim S., Schmid M., Ahn JH. DIP original experiment: DIP-265005X Science (New York, N.Y.) 2013 IMEx Regulation of temperature-responsive flowering by MADS-box transcription factor repressors. Regulation of temperature-responsive flowering by MADS-box transcription factor repressors. Regulation of temperature-responsive flowering by MADS-box transcription factor repressors. Science (New York, N.Y.) 2013 imex curation Lee JH., Ryu HS., Chung KS., Posé D., Kim S., Schmid M., Ahn JH. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Lee JH., Ryu HS., Chung KS., Posé D., Kim S., Schmid M., Ahn JH. DIP original experiment: DIP-264999X Science (New York, N.Y.) 2013 IMEx Regulation of temperature-responsive flowering by MADS-box transcription factor repressors. Regulation of temperature-responsive flowering by MADS-box transcription factor repressors. Regulation of temperature-responsive flowering by MADS-box transcription factor repressors. Science (New York, N.Y.) 2013 imex curation Lee JH., Ryu HS., Chung KS., Posé D., Kim S., Schmid M., Ahn JH. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Lee JH., Ryu HS., Chung KS., Posé D., Kim S., Schmid M., Ahn JH. DIP original experiment: DIP-265000X Science (New York, N.Y.) 2013 IMEx Regulation of temperature-responsive flowering by MADS-box transcription factor repressors. Regulation of temperature-responsive flowering by MADS-box transcription factor repressors. Regulation of temperature-responsive flowering by MADS-box transcription factor repressors. Science (New York, N.Y.) 2013 imex curation Lee JH., Ryu HS., Chung KS., Posé D., Kim S., Schmid M., Ahn JH. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Lee JH., Ryu HS., Chung KS., Posé D., Kim S., Schmid M., Ahn JH. DIP original experiment: DIP-265004X Science (New York, N.Y.) 2013 IMEx Regulation of temperature-responsive flowering by MADS-box transcription factor repressors. Regulation of temperature-responsive flowering by MADS-box transcription factor repressors. Regulation of temperature-responsive flowering by MADS-box transcription factor repressors. Science (New York, N.Y.) 2013 imex curation Lee JH., Ryu HS., Chung KS., Posé D., Kim S., Schmid M., Ahn JH. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Lee JH., Ryu HS., Chung KS., Posé D., Kim S., Schmid M., Ahn JH. DIP original experiment: DIP-265001X Science (New York, N.Y.) 2013 IMEx Regulation of temperature-responsive flowering by MADS-box transcription factor repressors. Regulation of temperature-responsive flowering by MADS-box transcription factor repressors. Regulation of temperature-responsive flowering by MADS-box transcription factor repressors. Science (New York, N.Y.) 2013 imex curation Lee JH., Ryu HS., Chung KS., Posé D., Kim S., Schmid M., Ahn JH. Only protein-protein interactions nicbe Nicotiana benthamiana anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Lee JH., Ryu HS., Chung KS., Posé D., Kim S., Schmid M., Ahn JH. DIP original experiment: DIP-265002X Science (New York, N.Y.) 2013 IMEx Regulation of temperature-responsive flowering by MADS-box transcription factor repressors. Regulation of temperature-responsive flowering by MADS-box transcription factor repressors. Regulation of temperature-responsive flowering by MADS-box transcription factor repressors. Science (New York, N.Y.) 2013 imex curation Lee JH., Ryu HS., Chung KS., Posé D., Kim S., Schmid M., Ahn JH. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Lee JH., Ryu HS., Chung KS., Posé D., Kim S., Schmid M., Ahn JH. DIP original experiment: DIP-264996X Science (New York, N.Y.) 2013 IMEx Regulation of temperature-responsive flowering by MADS-box transcription factor repressors. Regulation of temperature-responsive flowering by MADS-box transcription factor repressors. Regulation of temperature-responsive flowering by MADS-box transcription factor repressors. Science (New York, N.Y.) 2013 imex curation Lee JH., Ryu HS., Chung KS., Posé D., Kim S., Schmid M., Ahn JH. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Lee JH., Ryu HS., Chung KS., Posé D., Kim S., Schmid M., Ahn JH. DIP original experiment: DIP-264993X Science (New York, N.Y.) 2013 IMEx Regulation of temperature-responsive flowering by MADS-box transcription factor repressors. Regulation of temperature-responsive flowering by MADS-box transcription factor repressors. Regulation of temperature-responsive flowering by MADS-box transcription factor repressors. Science (New York, N.Y.) 2013 imex curation Lee JH., Ryu HS., Chung KS., Posé D., Kim S., Schmid M., Ahn JH. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Lee JH., Ryu HS., Chung KS., Posé D., Kim S., Schmid M., Ahn JH. DIP original experiment: DIP-264995X Science (New York, N.Y.) 2013 IMEx Regulation of temperature-responsive flowering by MADS-box transcription factor repressors. Regulation of temperature-responsive flowering by MADS-box transcription factor repressors. Regulation of temperature-responsive flowering by MADS-box transcription factor repressors. Science (New York, N.Y.) 2013 imex curation Lee JH., Ryu HS., Chung KS., Posé D., Kim S., Schmid M., Ahn JH. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Lee JH., Ryu HS., Chung KS., Posé D., Kim S., Schmid M., Ahn JH. DIP original experiment: DIP-264994X Science (New York, N.Y.) 2013 IMEx Regulation of temperature-responsive flowering by MADS-box transcription factor repressors. Regulation of temperature-responsive flowering by MADS-box transcription factor repressors. Regulation of temperature-responsive flowering by MADS-box transcription factor repressors. Science (New York, N.Y.) 2013 imex curation Lee JH., Ryu HS., Chung KS., Posé D., Kim S., Schmid M., Ahn JH. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Lee JH., Ryu HS., Chung KS., Posé D., Kim S., Schmid M., Ahn JH. DIP original experiment: DIP-264997X Science (New York, N.Y.) 2013 IMEx Regulation of temperature-responsive flowering by MADS-box transcription factor repressors. anxd1_arath Annexin D1 ANN1 ANNAT1 ANX23-ATH ATOXY5 OXY5 AnnAt1 Annexin A1 F14D7.2 At1g35720 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MATLKVSDSVPAPSDDAEQLRTAFEGWGTNEDLIISILAHRSAEQRKVIRQAYHETYGEDLLKTLDKELSNDFERAILLWTLEPGERDALLANEATKRWTSSNQVLMEVACTRTSTQLLHARQAYHARYKKSLEEDVAHHTTGDFRKLLVSLVTSYRYEGDEVNMTLAKQEAKLVHEKIKDKHYNDEDVIRILSTRSKAQINATFNRYQDDHGEEILKSLEEGDDDDKFLALLRSTIQCLTRPELYFVDVLRSAINKTGTDEGALTRIVTTRAEIDLKVIGEEYQRRNSIPLEKAITKDTRGDYEKMLVALLGEDDA DIP protein Q9SYT0 original sequence version: 111 92516D630325005F di191_arath Protein DEHYDRATION-INDUCED 19 DI19-1 At1g56280 DI19 F14G9.11 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDADSKRFLATLRSRSEMLMGFEEIDGDDDFQEEFACPFCAESYDIIGLCCHIDDEHTLESKNAVCPVCSLKVGVDIVAHITLHHGSLFKLQRKRKSRKSGTNSTLSLLRKELREGDLQRLLGFTSRNGSVASSVTPDPLLSSFISPTRSQSSPAPRQTKNVSEDKQIERKRQVFISPVSLKDREERRHKSEFVQRLLSSAIFDEV DIP protein Q39083 original sequence version: 74 F1E96902AB60B74B tsa1_arath TSK-associating protein 1 TSA1 F19K6.14 At1g52410 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEIYTMKTNFLVLALSLCILLSSFHEVSCQDDGSGLSNLDLIERDYQDSVNALQGKDDEDQSAKIQSENQNNTTVTDKNTISLSLSDESEVGSVSDESVGRSSLLDQIKLEFEAHHNSINQAGSDGVKAESKDDDEELSAHRQKMLEEIEHEFEAASDSLKQLKTDDVNEGNDEEHSAKRQSLLEEIEREFEAATKELEQLKVNDFTGDKDDEEHSAKRKSMLEAIEREFEAAMEGIEALKVSDSTGSGDDEEQSAKRLSMLEEIEREFEAASKGLEQLRASDSTADNNEEEHAAKGQSLLEEIEREFEAATESLKQLQVDDSTEDKEHFTAAKRQSLLEEIEREFEAATKDLKQLNDFTEGSADDEQSAKRNKMLEDIEREFEAATIGLEQLKANDFSEGNNNEEQSAKRKSMLEEIEREFEAAIGGLKQIKVDDSRNLEEESAKRKIILEEMEREFEEAHSGINAKADKEESAKKQSGSAIPEVLGLGQSGGCSCSKQDEDSSIVIPTKYSIEDILSEESAVQGTETSSLTASLTQLVENHRKEKESLLGHRVLTSPSIASSTSESSATSETVETLRAKLNELRGLTARELVTRKDFGQILITAASFEELSSAPISYISRLAKYRNVIKEGLEASERVHIAQVRAKMLKEVATEKQTAVDTHFATAKKLAQEGDALFVKIFAIKKLLAKLEAEKESVDGKFKETVKELSHLLADASEAYEEYHGAVRKAKDEQAAEEFAKEATQSAEIIWVKFLSSL DIP protein F4ICX9 original sequence version: 31 svp_arath MADS-box protein SVP Protein SHORT VEGETATIVE PHASE SVP F14M13.6 At2g22540 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAREKIQIRKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFEFCSSSMKEVLERHNLQSKNLEKLDQPSLELQLVENSDHARMSKEIADKSHRLRQMRGEELQGLDIEELQQLEKALETGLTRVIETKSDKIMSEISELQKKGMQLMDENKRLRQQGTQLTEENERLGMQICNNVHAHGGAESENAAVYEEGQSSESITNAGNSTGAPVDSESSDTSLRLGLPYGG DIP protein Q9FVC1 original sequence version: 83 DIP protein Q9FVC1 original sequence version: 104 C14F3B6A259DF26E vcs_arath Enhancer of mRNA-decapping protein 4 VCS EDC4 Protein VARICOSE MDC11.13 At3g13300 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MASSPGNTNPHNTPPFDLGILFKPSSNPYPPPAASYPPPTGPFLHNQYDQQHYAPPGISAQPSPVTQQQQDVSSSSAATNLHPQRTLSYPTPPLNLQSPRSNHNPGTHILALLNNTNNGAPVANQEPSHQLPVVNHNEIARSFPGGSGPIRVPSCKLPKGRRLIGEHAVYDVDVRLQGEIQPQLEVTPITKYGSDPQLVVGRQIAVNKVYICYGLKGGNIRVLNINTALRSLFRGHSQRVTDMAFFAEDVDMLASVSLDGKVFVWKISEGSEGEDQPQITGKIVLALQILGEEDTKHPRVCWHCHKQEILVVSIGKHVLRIDTTKVGRGEVFSAEAPLQCPLDKLIDGVQIVGKHDGEVTDLSMCQWMTTRLVSSSVDGTIKIWQDRKAQPLVVLRPHDGHPVSSATFVTSPERPDHIILITGGPLNREMKIWVSAGEEGWLLPADAESWRCTQTLDLKSSTEPRAEEAFFNQVIALSEAGLLLLANAKRNALYAVHLDYGSSPVGTRMDYLSEFTVTMPILSFIGTNDPPEEPIVKVYCVQTLAIQQYTLDLCLCLPPPIENMGLEKSDSSVSREANLVEGMSEPSGLKPTDLPSVDSVPKPSIIVNRSESANKLSFPSAEATSQAIVPPNGEPKTSGLPSQTSGAGSAYATLPQLPLSPRLSSKLSGYHTPVEAIEPVIPHHELGGKTPSADYSVDRQMDAVGERNLDVSSVEEISRSKDSNVTPDDDVSGMRSPSAFFKHPTHLVTPSEILMGVSSAEASITTEDRRDRDANIQDVNNDPRDTEVEVKEISEARSTQNGEINDHDETENCTSENREKVFCSQVSNLSTEMARDCYPSTEGTFIPGESKAYGQPIKAGDESGVDSRGGPAKLLKGKKQKAKNSQGPGLSSTSSNVANLADSFNEQSQSLSHPMTDLLPQLLAMQETMNQVMASQKEMQRQLSNAATGPIGKESKRLEVALGRMIEKSSKSNADALWARIQEETVKNEKALRDHAQQIVNATTNFMSKELNAMFEKTIKKELAAIGPALARSVVPVIEKTVSSAITESFQRGIGDKAVNQLDKSVNIKLEATVARQIQAQFQTSGKQALQEGLRSSVESSVIPSFEKACKAMFDQIDSAFQKGIAEHTNAAQQRFDSGHSQLAHTLKESITSASSVAQALSRELAETQRNLLALAAAGANSGGSNSLVTQLSGGPLGALLEKVEAPMDPTTELSRLISERKYEESFTSALQRSDVSIVSWLCSQVDLRGLLAMNPLPLSQGVLLSLLQQLACDISKDTSRKLAWMTDVVAAINPSDQMIAVHARPIFEQVYQILHHHRNAPGSDVSAIRLIMHVINSMLMGCK DIP protein Q9LTT8 original sequence version: 104 mint 5A32D32C46AB5BF4 mip1_arath MND1-interacting protein 1 At1g32530 MIP1 F5D14.31 T9G5.5 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGCTVREKHVKPTRRIKAAAFRSDPPLCWVEKIAMSQSIVENLVYHPGLTDSGSVNLNSVTENPEENFWAYCTEEHLEEILLKHLEFLYNQAVSKLLELGYEERVALKAVLSNGHCYGELDVLTNIVNNSLSYLNSGGGGGGSNGNGEDRTETGFTDLRDLEEYSLAGMIYLLQQVKPNLSKGDAMWCLLMSELHVGRASTLDVPTNRSSCCTKEDSNVEDVGTGGTLDIAGFMAPALCRFHGGWGFGNGGGPEFSGNGFSMKGAELKLQREIDCPKRFNLSPSMKSLLKRNVAAFAAGYRASMKQKQIQSSDTIGDSKACNDPAIVKSCGQQPRKSGSEESVSTVLEKFRDLNLDDNLESVGVDDKDCVIVDLLHQVKDFEKKVKERKEWAQKNAMQAAQKVSEELAELKTLSSEREGIQLLKKGKQAVEESTAKRFTDKEIELRKACSQNDRANVIVRKLENQNAEIRAEREGSKLSASESLKACMEASKKEKKCLKKLVAWEKQILKLQDEITAEKEKIKALYKTLAQITEYEKEIEAKWRQEQKAKEEALAQMEEEQRSKEAAEGHNKRKLETLRLKIELDFQRHKDDHQRLEQELGRLKASSDSDSSHISNNAWKPKKSQGENIAKLLEEIDKLEGSYDNEANYDRECIICMKDEVSVVFLPCAHQVVCGSCSDSFFASNNGGSKVTCPCCRGLVQQRIRIFGATS DIP protein Q8RX22 original sequence version: 86 1DDF44ADFBCC975F q9at76-1 Agamous-like MADS-box protein AGL27 AGL27 FK1 FLM MAF1 MADS box FLC1-like nuclear protein Protein FLOWERING LOCUS M Protein MADS AFFECTING FLOWERING 1 F22K20.15 At1g77080 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGRRKIEIKRIENKSSRQVTFSKRRNGLIDKARQLSILCESSVAVVVVSASGKLYDSSSGDDISKIIDRYEIQHADELRALDLEEKIQNYLPHKELLETVQSKLEEPNVDNVSVDSLISLEEQLETALSVSRARKAELMMEYIESLKEKEKLLREENQVLASQMGKNTLLATDDERGMFPGSSSGNKIPETLPLLN DIP protein Q9AT76-1 original sequence version: 103 DIP protein Q9AT76 original sequence version: 96 agl27-svp-1 11 18 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 21 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association svp-svp-1 7 18 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 18 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association agl27-agl27-1 3 21 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 21 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association agl27-svp-2 13 18 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 21 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association agl27-vcs-1 5 19 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 21 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association agl27-mip1-1 6 20 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 21 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association svp-agl27-1 4 18 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 21 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association svp-agl27-2 12 18 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 21 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association agl27-svp-3 1 18 unspecified role unspecified role unspecified role unspecified role nYFP-tag nYFP-tag nyfp nYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range allce Allium cepa (Onion) Onion 21 unspecified role unspecified role unspecified role unspecified role cYFP-tag cYFP-tag cyfp cYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range allce Allium cepa (Onion) Onion physical association physical association agl27-tsa1-1 10 17 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 21 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association svp-agl27-3 8 18 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli 21 unspecified role unspecified role prey prey 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro direct interaction direct interaction agl27-ann1-1 14 15 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 21 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association agl27-svp-4 9 18 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range nicbe Nicotiana benthamiana 21 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range nicbe Nicotiana benthamiana physical association physical association agl27-di19_1-1 2 16 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 21 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association